Recombinant Human DUSP23, His-tagged
Cat.No. : | DUSP23-26909TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-150 of Human DUSP23, with an N-terminal His tag, 170aa, 18.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 150 amino acids |
Description : | DUSP23, also known as low molecular mass dual specificity phosphatase 3(LDP-3), belongs to the protein-tyrosine phosphatase family. |
Conjugation : | HIS |
Molecular Weight : | 18.800kDa inclusive of tags |
Tissue specificity : | Widely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGVQPPNFSWVLPGRLAGLA LPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFG RTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK AVFQFYQRTK |
Sequence Similarities : | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain. |
Gene Name | DUSP23 dual specificity phosphatase 23 [ Homo sapiens ] |
Official Symbol | DUSP23 |
Synonyms | DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442; |
Gene ID | 54935 |
mRNA Refseq | NM_017823 |
Protein Refseq | NP_060293 |
Uniprot ID | Q9BVJ7 |
Chromosome Location | 1q23.1 |
Function | hydrolase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; |
◆ Recombinant Proteins | ||
DUSP23-301625H | Recombinant Human DUSP23 protein, GST-tagged | +Inquiry |
DUSP23-2568M | Recombinant Mouse DUSP23 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP23-4106HF | Recombinant Full Length Human DUSP23 Protein, GST-tagged | +Inquiry |
DUSP23-4885M | Recombinant Mouse DUSP23 Protein | +Inquiry |
DUSP23-26909TH | Recombinant Human DUSP23, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP23-6776HCL | Recombinant Human DUSP23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP23 Products
Required fields are marked with *
My Review for All DUSP23 Products
Required fields are marked with *
0
Inquiry Basket