Recombinant Human DUSP28 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DUSP28-5241H |
| Product Overview : | DUSP28 MS Standard C13 and N15-labeled recombinant protein (NP_001028747) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | DUSP28 (Dual Specificity Phosphatase 28) is a Protein Coding gene. Diseases associated with DUSP28 include Sveinsson Chorioretinal Atrophy. Gene Ontology (GO) annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is SSH3. |
| Molecular Mass : | 18.3 kDa |
| AA Sequence : | MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DUSP28 dual specificity phosphatase 28 [ Homo sapiens (human) ] |
| Official Symbol | DUSP28 |
| Synonyms | DUSP28; dual specificity phosphatase 28; DUSP26; VHP; |
| Gene ID | 285193 |
| mRNA Refseq | NM_001033575 |
| Protein Refseq | NP_001028747 |
| UniProt ID | Q4G0W2 |
| ◆ Recombinant Proteins | ||
| DUSP28-4888M | Recombinant Mouse DUSP28 Protein | +Inquiry |
| DUSP28-2571M | Recombinant Mouse DUSP28 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Dusp28-2688M | Recombinant Mouse Dusp28 Protein, Myc/DDK-tagged | +Inquiry |
| DUSP28-2635H | Recombinant Human DUSP28 Protein, MYC/DDK-tagged | +Inquiry |
| DUSP28-4668C | Recombinant Chicken DUSP28 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP28 Products
Required fields are marked with *
My Review for All DUSP28 Products
Required fields are marked with *
