Recombinant Human DUSP4, GST-tagged

Cat.No. : DUSP4-101H
Product Overview : Human DUSP4 full-length ORF ( AAH02671, 1 a.a. - 394 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported.
Molecular Mass : 69.08 kDa
AA Sequence : MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGYILGSVNVRCNTIVRR RAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERF SSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITAL LNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVH SAPSSLPYLHSPITTSPSC
Applications : ELISA; WB; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP4 dual specificity phosphatase 4 [ Homo sapiens (human) ]
Official Symbol DUSP4
Synonyms DUSP4; TYP; HVH2; MKP2; MKP-2; dual specificity phosphatase 4; MAP kinase phosphatase 2; VH1 homologous phosphatase 2; dual specificity protein phosphatase hVH2; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 2; EC 3.1.3.16; EC 3.1.3.48
Gene ID 1846
mRNA Refseq NM_001394
Protein Refseq NP_001385
MIM 602747
UniProt ID Q13115
Chromosome Location 8p12-p11
Pathway Activated TLR4 signalling; B Cell Receptor Signaling Pathway; ERK/MAPK targets
Function MAP kinase tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine/threonine phosphatase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP4 Products

Required fields are marked with *

My Review for All DUSP4 Products

Required fields are marked with *

0
cart-icon