Recombinant Human DUSP4, GST-tagged
Cat.No. : | DUSP4-101H |
Product Overview : | Human DUSP4 full-length ORF ( AAH02671, 1 a.a. - 394 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported. |
Molecular Mass : | 69.08 kDa |
AA Sequence : | MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGYILGSVNVRCNTIVRR RAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERF SSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITAL LNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGVH SAPSSLPYLHSPITTSPSC |
Applications : | ELISA; WB; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DUSP4 dual specificity phosphatase 4 [ Homo sapiens (human) ] |
Official Symbol | DUSP4 |
Synonyms | DUSP4; TYP; HVH2; MKP2; MKP-2; dual specificity phosphatase 4; MAP kinase phosphatase 2; VH1 homologous phosphatase 2; dual specificity protein phosphatase hVH2; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 2; EC 3.1.3.16; EC 3.1.3.48 |
Gene ID | 1846 |
mRNA Refseq | NM_001394 |
Protein Refseq | NP_001385 |
MIM | 602747 |
UniProt ID | Q13115 |
Chromosome Location | 8p12-p11 |
Pathway | Activated TLR4 signalling; B Cell Receptor Signaling Pathway; ERK/MAPK targets |
Function | MAP kinase tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; protein tyrosine/threonine phosphatase activity |
◆ Recombinant Proteins | ||
DUSP4-105H | Recombinant Human DUSP4 Protein, Myc/DDK-tagged | +Inquiry |
DUSP4-106H | Active Recombinant Human DUSP4 Protein, His-tagged | +Inquiry |
DUSP4-2572M | Recombinant Mouse DUSP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP4-11388Z | Recombinant Zebrafish DUSP4 | +Inquiry |
DUSP4-138HF | Recombinant Full Length Human DUSP4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUSP4-6773HCL | Recombinant Human DUSP4 293 Cell Lysate | +Inquiry |
DUSP4-6774HCL | Recombinant Human DUSP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP4 Products
Required fields are marked with *
My Review for All DUSP4 Products
Required fields are marked with *
0
Inquiry Basket