Recombinant Human DUSP6 protein, His-tagged
| Cat.No. : | DUSP6-3133H |
| Product Overview : | Recombinant Human DUSP6 protein(73-133 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 73-133 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEGCRAFYLE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DUSP6 dual specificity phosphatase 6 [ Homo sapiens ] |
| Official Symbol | DUSP6 |
| Synonyms | DUSP6; dual specificity phosphatase 6; dual specificity protein phosphatase 6; MKP 3; PYST1; MAP kinase phosphatase 3; dual specificity protein phosphatase PYST1; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 3; MKP3; |
| Gene ID | 1848 |
| mRNA Refseq | NM_001946 |
| Protein Refseq | NP_001937 |
| MIM | 602748 |
| UniProt ID | Q16828 |
| ◆ Recombinant Proteins | ||
| DUSP6-384H | Recombinant Human DUSP6 Protein, His-tagged | +Inquiry |
| DUSP6-5116H | Recombinant Human DUSP6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DUSP6-666H | Active Recombinant Human DUSP6, GST-tagged | +Inquiry |
| DUSP6-385H | Recombinant Human DUSP6 protein, His-Myc-tagged | +Inquiry |
| DUSP6-4892M | Recombinant Mouse DUSP6 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DUSP6-6770HCL | Recombinant Human DUSP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP6 Products
Required fields are marked with *
My Review for All DUSP6 Products
Required fields are marked with *
