Recombinant Human DUT protein, His-tagged
| Cat.No. : | DUT-791H | 
| Product Overview : | Recombinant Human DUT(Met1-Asn164) fused with His tag at N-terminal was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Met1-Asn164 | 
| Description : | Deoxyuridine5'-TriphosphateNucleotidohydrolaseMitochondrial(dUTPase)belongstothedUTPasefamily.dUTPaseexitsasahomotrimerandisinvolvedinnucleotidemetabolism.dUTPaseproducesdUMP,theimmediateprecursorofthymidinenucleotidesanditdecreasestheintracellularconcentrationofdUTPsothaturacilcannotbeincorporatedintoDNA.ThedUTPaseincreaseinPCRproductyield,lengthandfidelityenablesfurtherdown-streamapplications.TheseeffectsmakedUTPaseusefulinPCRfidelityandyield-sensitiveapplications. dUTPase is specific for dUTP and is critical for the fidelity of DNA replication and repair. | 
| Form : | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. | 
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYD YTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN | 
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). | 
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. | 
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. | 
| Shipping : | The product is shipped on dry ice/polar packs.Upon receipt, store it immediately at the temperature listed below. | 
| Gene Name | DUT deoxyuridine triphosphatase [ Homo sapiens ] | 
| Official Symbol | DUT | 
| Synonyms | DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622; | 
| Gene ID | 1854 | 
| mRNA Refseq | NM_001025248 | 
| Protein Refseq | NP_001020419 | 
| MIM | 601266 | 
| UniProt ID | P33316 | 
| Chromosome Location | 15q21.1 | 
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem; | 
| Function | dUTP diphosphatase activity; hydrolase activity; protein binding; | 
| ◆ Recombinant Proteins | ||
| DUT-3527C | Recombinant Chicken DUT | +Inquiry | 
| Dut-449M | Recombinant Mouse Dut Protein, MYC/DDK-tagged | +Inquiry | 
| DUT-1979R | Recombinant Rat Dut protein, His-tagged | +Inquiry | 
| DUT-27878TH | Recombinant Human DUT, His-tagged | +Inquiry | 
| DUT-77H | Recombinant Human DUT protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            