"DUT" Related Products

Expand
Expand

Recombinant Human DUT protein, His-tagged

Cat.No.: DUT-791H
Product Overview: Recombinant Human DUT(Met1-Asn164) fused with His tag at N-terminal was expressed in E. coli.
Description: Deoxyuridine5'-TriphosphateNucleotidohydrolaseMitochondrial(dUTPase)belongstothedUTPasefamily.dUTPaseexitsasahomotrimerandisinvolvedinnucleotidemetabolism.dUTPaseproducesdUMP,theimmediateprecursorofthymidinenucleotidesanditdecreasestheintracellularconcentrationofdUTPsothaturacilcannotbeincorporatedintoDNA.ThedUTPaseincreaseinPCRproductyield,lengthandfidelityenablesfurtherdown-streamapplications.TheseeffectsmakedUTPaseusefulinPCRfidelityandyield-sensitiveapplications. dUTPase is specific for dUTP and is critical for the fidelity of DNA replication and repair.
Source: E. coli
Species: Human
Tag: His
Form: Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Protein length: Met1-Asn164
AA Sequence: MGSSHHHHHHSSGLVPRGSHMPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYD YTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Shipping: The product is shipped on dry ice/polar packs.Upon receipt, store it immediately at the temperature listed below.
Gene Name: DUT deoxyuridine triphosphatase [ Homo sapiens ]
Official Symbol: DUT
Synonyms: DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622;
Gene ID: 1854
mRNA Refseq: NM_001025248
Protein Refseq: NP_001020419
MIM: 601266
UniProt ID: P33316
Chromosome Location: 15q21.1
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;
Function: dUTP diphosphatase activity; hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.