Recombinant Human DUT protein, His-tagged
| Cat.No. : | DUT-791H |
| Product Overview : | Recombinant Human DUT(Met1-Asn164) fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Met1-Asn164 |
| Description : | Deoxyuridine5'-TriphosphateNucleotidohydrolaseMitochondrial(dUTPase)belongstothedUTPasefamily.dUTPaseexitsasahomotrimerandisinvolvedinnucleotidemetabolism.dUTPaseproducesdUMP,theimmediateprecursorofthymidinenucleotidesanditdecreasestheintracellularconcentrationofdUTPsothaturacilcannotbeincorporatedintoDNA.ThedUTPaseincreaseinPCRproductyield,lengthandfidelityenablesfurtherdown-streamapplications.TheseeffectsmakedUTPaseusefulinPCRfidelityandyield-sensitiveapplications. dUTPase is specific for dUTP and is critical for the fidelity of DNA replication and repair. |
| Form : | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYD YTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
| Shipping : | The product is shipped on dry ice/polar packs.Upon receipt, store it immediately at the temperature listed below. |
| Gene Name | DUT deoxyuridine triphosphatase [ Homo sapiens ] |
| Official Symbol | DUT |
| Synonyms | DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622; |
| Gene ID | 1854 |
| mRNA Refseq | NM_001025248 |
| Protein Refseq | NP_001020419 |
| MIM | 601266 |
| UniProt ID | P33316 |
| Chromosome Location | 15q21.1 |
| Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem; |
| Function | dUTP diphosphatase activity; hydrolase activity; protein binding; |
| ◆ Recombinant Proteins | ||
| DUT-3527C | Recombinant Chicken DUT | +Inquiry |
| DUT-78H | Recombinant Human DUT protein | +Inquiry |
| DUT-77H | Recombinant Human DUT protein, His-tagged | +Inquiry |
| DUT-1524Z | Recombinant Zebrafish DUT | +Inquiry |
| DUT-2950H | Recombinant Human DUT Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DUT-147HKCL | Human DUT Knockdown Cell Lysate | +Inquiry |
| DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *
