Recombinant Human DUT protein, His-tagged
Cat.No. : | DUT-791H |
Product Overview : | Recombinant Human DUT(Met1-Asn164) fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met1-Asn164 |
Description : | Deoxyuridine5'-TriphosphateNucleotidohydrolaseMitochondrial(dUTPase)belongstothedUTPasefamily.dUTPaseexitsasahomotrimerandisinvolvedinnucleotidemetabolism.dUTPaseproducesdUMP,theimmediateprecursorofthymidinenucleotidesanditdecreasestheintracellularconcentrationofdUTPsothaturacilcannotbeincorporatedintoDNA.ThedUTPaseincreaseinPCRproductyield,lengthandfidelityenablesfurtherdown-streamapplications.TheseeffectsmakedUTPaseusefulinPCRfidelityandyield-sensitiveapplications. dUTPase is specific for dUTP and is critical for the fidelity of DNA replication and repair. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYD YTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/polar packs.Upon receipt, store it immediately at the temperature listed below. |
Gene Name | DUT deoxyuridine triphosphatase [ Homo sapiens ] |
Official Symbol | DUT |
Synonyms | DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622; |
Gene ID | 1854 |
mRNA Refseq | NM_001025248 |
Protein Refseq | NP_001020419 |
MIM | 601266 |
UniProt ID | P33316 |
Chromosome Location | 15q21.1 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem; |
Function | dUTP diphosphatase activity; hydrolase activity; protein binding; |
◆ Recombinant Proteins | ||
DUT-77H | Recombinant Human DUT protein, His-tagged | +Inquiry |
DUT-12221H | Recombinant Human DUT, GST-tagged | +Inquiry |
DUT-791H | Recombinant Human DUT protein, His-tagged | +Inquiry |
dUTPase-88 | Active Recombinant Thermostable dUTPase | +Inquiry |
DUT-4123HF | Recombinant Full Length Human DUT Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *