Recombinant Human DXO Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DXO-3723H
• Product Overview: DOM3Z MS Standard C13 and N15-labeled recombinant protein (NP_005501) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. The function of its protein product is unknown, but its ubiquitous expression and conservation in both simple and complex eukaryotes suggests that this may be a housekeeping gene.
• Molecular Mass: 44.9 kDa
• AA Sequence: MDPRGTKRGAEKTEVAEPRNKLPRPAPSLPTDPALYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPTNGPGPNFDLRDGYPDRYQPRDEEVQERLDHLLCWLLEHRGRLEGGPGWLAEAIVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPNARAQRLARPPLLRELMYMGYKFEQYMCADKPGSSPDPSGEVNTNVAFCSVLRSRLGSHPLLFSGEVDCTDPQAPSTQPPTCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPNVVAGFRNPDGFVSSLKTFPTMKMFEYVRNDRDGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHQDAPYAFLPIWYVEAMTQDLPSPPKTPSPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DXO decapping exoribonuclease [ Homo sapiens (human) ]
• Official Symbol: DXO
• Synonyms: DXO; decapping exoribonuclease; NG6; RAI1; DOM3L; DOM3Z; decapping and exoribonuclease protein; 5'-3' exoribonuclease DXO; NAD-capped RNA hydrolase DXO; deNADding enzyme DXO; protein Dom3Z; EC 3.6.1.-
• Gene ID: 1797
• mRNA Refseq: NM_005510
• Protein Refseq: NP_005501
• MIM: 605996
• UniProt ID: O77932