Recombinant Human DYNC1H1 Protein, GST-tagged
Cat.No. : | DYNC1H1-2965H |
Product Overview : | Human DNCH1 partial ORF ( AAH21297, 733 a.a. - 832 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | TSQGATLDACSFGVTGLKLQGATCNNNKLSLSNAISTALPLTQLRWVKQTNTEKKASVVTLPVYLNFTRADLIFTVDFEIATKEDPRSFYERGVAVLCTE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYNC1H1 dynein, cytoplasmic 1, heavy chain 1 [ Homo sapiens ] |
Official Symbol | DYNC1H1 |
Synonyms | DYNC1H1; dynein, cytoplasmic 1, heavy chain 1; DNCH1, DNCL, DNECL, dynein, cytoplasmic, heavy polypeptide 1; cytoplasmic dynein 1 heavy chain 1; DHC1; Dnchc1; HL 3; p22; dynein heavy chain, cytosolic; cytoplasmic dynein heavy chain 1; dynein, cytoplasmic, heavy polypeptide 1; DNCL; DYHC; HL-3; CMT20; DHC1a; DNCH1; DNECL; MRD13; KIAA0325; DKFZp686P2245; |
Gene ID | 1778 |
mRNA Refseq | NM_001376 |
Protein Refseq | NP_001367 |
MIM | 600112 |
UniProt ID | Q14204 |
◆ Recombinant Proteins | ||
DYNC1H1-1975H | Recombinant Human DYNC1H1 Protein (Ala20-Leu285), N-His tagged | +Inquiry |
DYNC1H1-2579M | Recombinant Mouse DYNC1H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DYNC1H1-3835Z | Recombinant Zebrafish DYNC1H1 | +Inquiry |
DYNC1H1-1981R | Recombinant Rat DYNC1H1 Protein | +Inquiry |
DYNC1H1-1637H | Recombinant Human DYNC1H1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNC1H1-519HCL | Recombinant Human DYNC1H1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNC1H1 Products
Required fields are marked with *
My Review for All DYNC1H1 Products
Required fields are marked with *