Recombinant Human DYNC1LI1 Protein, GST-tagged

Cat.No. : DYNC1LI1-2969H
Product Overview : Human DYNC1LI1 full-length ORF (1 a.a. - 523 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to light intermediate subunit family, whose members are components of the multiprotein cytoplasmic dynein complex, which is involved in intracellular trafficking and chromosome segregation during mitosis. The protein plays a role in moving the spindle assembly checkpoint (SAC) from kinetochores to spindle poles. The protein may also mediate binding to other cargo molecules to facilitate intracellular vesicle trafficking. [provided by RefSeq, Jul 2016]
Molecular Mass : 83 kDa
AA Sequence : MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRSRSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDKDRDDQTRCNVWILDGDLYHKGLLKFSLDAVSLKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLTHNLGIPVLVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYIVQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRKFVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASVSPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGLPPSTKKSGQKPVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DYNC1LI1 dynein, cytoplasmic 1, light intermediate chain 1 [ Homo sapiens ]
Official Symbol DYNC1LI1
Synonyms DYNC1LI1; dynein, cytoplasmic 1, light intermediate chain 1; DNCLI1, dynein, cytoplasmic, light intermediate polypeptide 1; cytoplasmic dynein 1 light intermediate chain 1; DLC-A; dynein light chain A; dynein light chain-A; dynein light intermediate chain 1, cytosolic; dynein, cytoplasmic, light intermediate polypeptide 1; LIC1; DNCLI1; FLJ10219;
Gene ID 51143
mRNA Refseq NM_016141
Protein Refseq NP_057225
MIM 615890
UniProt ID Q9Y6G9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DYNC1LI1 Products

Required fields are marked with *

My Review for All DYNC1LI1 Products

Required fields are marked with *

0
cart-icon