Recombinant Human DYNC1LI1 protein, GST-tagged
Cat.No. : | DYNC1LI1-077H |
Product Overview : | Recombinant Human DYNC1LI1 protein(167-233 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 167-233 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DYNC1LI1 dynein, cytoplasmic 1, light intermediate chain 1 [ Homo sapiens ] |
Official Symbol | DYNC1LI1 |
Synonyms | DYNC1LI1; dynein, cytoplasmic 1, light intermediate chain 1; DNCLI1, dynein, cytoplasmic, light intermediate polypeptide 1; cytoplasmic dynein 1 light intermediate chain 1; DLC-A; dynein light chain A; dynein light chain-A; dynein light intermediate chain 1, cytosolic; dynein, cytoplasmic, light intermediate polypeptide 1; LIC1; DNCLI1; FLJ10219; |
Gene ID | 51143 |
mRNA Refseq | NM_016141 |
Protein Refseq | NP_057225 |
UniProt ID | Q9Y6G9 |
◆ Recombinant Proteins | ||
DYNC1LI1-5919Z | Recombinant Zebrafish DYNC1LI1 | +Inquiry |
DYNC1LI1-4024C | Recombinant Chicken DYNC1LI1 | +Inquiry |
DYNC1LI1-2969H | Recombinant Human DYNC1LI1 Protein, GST-tagged | +Inquiry |
DYNC1LI1-2777H | Recombinant Human DYNC1LI1 Protein, His-tagged | +Inquiry |
DYNC1LI1-1641R | Recombinant Rat DYNC1LI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNC1LI1-6762HCL | Recombinant Human DYNC1LI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNC1LI1 Products
Required fields are marked with *
My Review for All DYNC1LI1 Products
Required fields are marked with *