Recombinant Human DYNC1LI1 protein, GST-tagged

• Cat.No.: DYNC1LI1-077H
• Product Overview: Recombinant Human DYNC1LI1 protein(167-233 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 167-233 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: DYNC1LI1 dynein, cytoplasmic 1, light intermediate chain 1 [ Homo sapiens ]
• Official Symbol: DYNC1LI1
• Synonyms: DYNC1LI1; dynein, cytoplasmic 1, light intermediate chain 1; DNCLI1, dynein, cytoplasmic, light intermediate polypeptide 1; cytoplasmic dynein 1 light intermediate chain 1; DLC-A; dynein light chain A; dynein light chain-A; dynein light intermediate chain 1, cytosolic; dynein, cytoplasmic, light intermediate polypeptide 1; LIC1; DNCLI1; FLJ10219
• Gene ID: 51143
• mRNA Refseq: NM_016141
• Protein Refseq: NP_057225
• UniProt ID: Q9Y6G9