Recombinant Human DYNLL2 protein, GST-tagged
Cat.No. : | DYNLL2-12232H |
Product Overview : | Recombinant Human DYNLL2 protein(1-89 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-89 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | DYNLL2 |
Synonyms | DYNLL2; dynein, light chain, LC8-type 2; dynein light chain 2, cytoplasmic; Dlc2; DNCL1B; MGC17810; radial spoke 22 homolog (Chlamydomonas); RSPH22; DLC8b; radial spoke 22 homolog; 8 kDa dynein light chain b; |
Gene ID | 140735 |
mRNA Refseq | NM_080677 |
Protein Refseq | NP_542408 |
MIM | 608942 |
UniProt ID | Q96FJ2 |
◆ Recombinant Proteins | ||
DYNLL2-1646R | Recombinant Rat DYNLL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DYNLL2-3698H | Recombinant Human DYNLL2 protein, His-tagged | +Inquiry |
DYNLL2-3547H | Recombinant Human Dynein Light Chain 2, LC8-type2, His-tagged | +Inquiry |
DYNLL2-1988R | Recombinant Rat DYNLL2 Protein | +Inquiry |
DYNLL2-5633C | Recombinant Chicken DYNLL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLL2-6756HCL | Recombinant Human DYNLL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYNLL2 Products
Required fields are marked with *
My Review for All DYNLL2 Products
Required fields are marked with *
0
Inquiry Basket