Recombinant Human DYNLL2 protein, GST-tagged

Cat.No. : DYNLL2-12232H
Product Overview : Recombinant Human DYNLL2 protein(1-89 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability January 09, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-89 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol DYNLL2
Synonyms DYNLL2; dynein, light chain, LC8-type 2; dynein light chain 2, cytoplasmic; Dlc2; DNCL1B; MGC17810; radial spoke 22 homolog (Chlamydomonas); RSPH22; DLC8b; radial spoke 22 homolog; 8 kDa dynein light chain b;
Gene ID 140735
mRNA Refseq NM_080677
Protein Refseq NP_542408
MIM 608942
UniProt ID Q96FJ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DYNLL2 Products

Required fields are marked with *

My Review for All DYNLL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon