Recombinant Human E2F3
Cat.No. : | E2F3-27375TH |
Product Overview : | Recombinant full length Human E2F3 with N terminal proprietary tag, 40.74kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 133 amino acids |
Description : | The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 40.740kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFS SSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKC LLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVI LFASCTKLIFSKV |
Sequence Similarities : | Belongs to the E2F/DP family. |
Gene Name | E2F3 E2F transcription factor 3 [ Homo sapiens ] |
Official Symbol | E2F3 |
Synonyms | E2F3; E2F transcription factor 3; transcription factor E2F3; |
Gene ID | 1871 |
mRNA Refseq | NM_001243076 |
Protein Refseq | NP_001230005 |
MIM | 600427 |
Uniprot ID | O00716 |
Chromosome Location | 6p22 |
Pathway | Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; CDC6 association with the ORC:origin complex, organism-specific biosystem; |
Function | DNA binding; core promoter binding; cyclin-dependent protein kinase activity; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
E2F3-5118Z | Recombinant Zebrafish E2F3 | +Inquiry |
E2F3-3006H | Recombinant Human E2F3 Protein, GST-tagged | +Inquiry |
E2F3-4112HF | Recombinant Full Length Human E2F3 Protein, GST-tagged | +Inquiry |
E2F3-27375TH | Recombinant Human E2F3 | +Inquiry |
E2F3-118H | Recombinant Human E2F3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
E2F3-6742HCL | Recombinant Human E2F3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E2F3 Products
Required fields are marked with *
My Review for All E2F3 Products
Required fields are marked with *
0
Inquiry Basket