Recombinant Human EBF3 Protein, GST-tagged
Cat.No. : | EBF3-3021H |
Product Overview : | Human EBF3 full-length ORF (1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma. [provided by RefSeq, Sep 2011] |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKVSANTRSHPLSF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EBF3 early B-cell factor 3 [ Homo sapiens ] |
Official Symbol | EBF3 |
Synonyms | EBF3; early B-cell factor 3; COE3; DKFZp667B0210; |
Gene ID | 253738 |
mRNA Refseq | NM_001005463 |
Protein Refseq | NP_001005463 |
MIM | 607407 |
UniProt ID | Q9H4W6 |
◆ Recombinant Proteins | ||
EBF3-3021H | Recombinant Human EBF3 Protein, GST-tagged | +Inquiry |
Ebf3-2711M | Recombinant Mouse Ebf3 Protein, Myc/DDK-tagged | +Inquiry |
EBF3-4141HF | Recombinant Full Length Human EBF3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBF3-6735HCL | Recombinant Human EBF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EBF3 Products
Required fields are marked with *
My Review for All EBF3 Products
Required fields are marked with *
0
Inquiry Basket