Recombinant Human EBI3 Protein

Cat.No. : EBI3-3024H
Product Overview : Human EBI3 recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008]
Form : Lyophilized
Molecular Mass : 23.3 kDa
AA Sequence : MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Endotoxin : < 0.1 EU/μg
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade.After reconstitution with sterilized water, store at -20 centigrade or lower.Aliquot to avoid repeated freezing and thawing.
Storage Buffer : No additive
Gene Name EBI3 Epstein-Barr virus induced 3 [ Homo sapiens ]
Official Symbol EBI3
Synonyms EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B;
Gene ID 10148
mRNA Refseq NM_005755
Protein Refseq NP_005746
MIM 605816
UniProt ID Q14213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EBI3 Products

Required fields are marked with *

My Review for All EBI3 Products

Required fields are marked with *

0
cart-icon
0
compare icon