Recombinant Human EBI3 Protein
Cat.No. : | EBI3-3024H |
Product Overview : | Human EBI3 recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008] |
Form : | Lyophilized |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
Endotoxin : | < 0.1 EU/μg |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -20 centigrade.After reconstitution with sterilized water, store at -20 centigrade or lower.Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | No additive |
Gene Name | EBI3 Epstein-Barr virus induced 3 [ Homo sapiens ] |
Official Symbol | EBI3 |
Synonyms | EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B; |
Gene ID | 10148 |
mRNA Refseq | NM_005755 |
Protein Refseq | NP_005746 |
MIM | 605816 |
UniProt ID | Q14213 |
◆ Recombinant Proteins | ||
EBI3-8522H | Recombinant Human EBI3, His tagged | +Inquiry |
Ebi3-239M | Active Recombinant Mouse Ebi3 Protein (Ala23-Pro228), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Ebi3-8702M | Recombinant Mouse Ebi3, His tagged | +Inquiry |
EBI3-45H | Recombinant Human EBI3 | +Inquiry |
EBI3-06H | Active Recombinant Human EBI3 Protein (Arg21-Lys229), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EBI3 Products
Required fields are marked with *
My Review for All EBI3 Products
Required fields are marked with *
0
Inquiry Basket