Recombinant Human EBI3 Protein
| Cat.No. : | EBI3-3024H |
| Product Overview : | Human EBI3 recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008] |
| Form : | Lyophilized |
| Molecular Mass : | 23.3 kDa |
| AA Sequence : | MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
| Endotoxin : | < 0.1 EU/μg |
| Applications : | Functional Study SDS-PAGE |
| Storage : | Store at -20 centigrade.After reconstitution with sterilized water, store at -20 centigrade or lower.Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | No additive |
| Gene Name | EBI3 Epstein-Barr virus induced 3 [ Homo sapiens ] |
| Official Symbol | EBI3 |
| Synonyms | EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B; |
| Gene ID | 10148 |
| mRNA Refseq | NM_005755 |
| Protein Refseq | NP_005746 |
| MIM | 605816 |
| UniProt ID | Q14213 |
| ◆ Recombinant Proteins | ||
| EBI3-287H | Recombinant Human EBI3, Fc tagged | +Inquiry |
| EBI3-72H | Recombinant Human IL-35 Heterodimer Protein | +Inquiry |
| EBI3-975HF | Recombinant Full Length Human EBI3 Protein, GST-tagged | +Inquiry |
| EBI3-70M | Recombinant Macaque EBI3 subunit (IL-27/IL-35) Protein | +Inquiry |
| EBI3-59H | Recombinant Active Human EBI3 Protein, His-tagged(C-ter) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EBI3 Products
Required fields are marked with *
My Review for All EBI3 Products
Required fields are marked with *
