Recombinant Human ECE1 protein, His-tagged
Cat.No. : | ECE1-3668H |
Product Overview : | Recombinant Human ECE1 protein(90-189 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 90-189 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNET |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ECE1 endothelin converting enzyme 1 [ Homo sapiens ] |
Official Symbol | ECE1 |
Synonyms | ECE1; endothelin converting enzyme 1; ECE; endothelin-converting enzyme 1; ECE-1; |
Gene ID | 1889 |
mRNA Refseq | NM_001113347 |
Protein Refseq | NP_001106818 |
MIM | 600423 |
UniProt ID | P42892 |
◆ Recombinant Proteins | ||
RFL30038HF | Recombinant Full Length Human Endothelin-Converting Enzyme 1(Ece1) Protein, His-Tagged | +Inquiry |
Ece1-2688R | Recombinant Rat Ece1 protein, His & T7-tagged | +Inquiry |
Ece1-38M | Recombinant Mouse Ece1 protein, His-tagged | +Inquiry |
Ece1-2715M | Recombinant Mouse Ece1 Protein, Myc/DDK-tagged | +Inquiry |
ECE1-3668H | Recombinant Human ECE1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECE1-2023HCL | Recombinant Human ECE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECE1 Products
Required fields are marked with *
My Review for All ECE1 Products
Required fields are marked with *