Recombinant Human ECHDC1 protein, GST-tagged
| Cat.No. : | ECHDC1-3746H |
| Product Overview : | Recombinant Human ECHDC1 protein(170-301 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 170-301 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNK |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens ] |
| Official Symbol | ECHDC1 |
| Synonyms | ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110; |
| Gene ID | 55862 |
| mRNA Refseq | NM_001002030 |
| Protein Refseq | NP_001002030 |
| MIM | 612136 |
| UniProt ID | Q9NTX5 |
| ◆ Recombinant Proteins | ||
| ECHDC1-4966M | Recombinant Mouse ECHDC1 Protein | +Inquiry |
| ECHDC1-3746H | Recombinant Human ECHDC1 protein, GST-tagged | +Inquiry |
| ECHDC1-1659R | Recombinant Rat ECHDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECHDC1-3032H | Recombinant Human ECHDC1 Protein, GST-tagged | +Inquiry |
| ECHDC1-4163HF | Recombinant Full Length Human ECHDC1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ECHDC1-526HCL | Recombinant Human ECHDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECHDC1 Products
Required fields are marked with *
My Review for All ECHDC1 Products
Required fields are marked with *
