Recombinant Human ECSIT protein, His-tagged
Cat.No. : | ECSIT-3780H |
Product Overview : | Recombinant Human ECSIT protein(49 - 267 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 49 - 267 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SSEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ECSIT ECSIT homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | ECSIT |
Synonyms | ECSIT; ECSIT homolog (Drosophila); evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial; signaling intermediate in Toll pathway evolutionarily conserved ortholog (mouse); SITPEC; likely ortholog of mouse signaling intermediate in Toll pathway evolutionarily conserved; |
Gene ID | 51295 |
mRNA Refseq | NM_001142464 |
Protein Refseq | NP_001135936 |
MIM | 608388 |
UniProt ID | Q9BQ95 |
◆ Recombinant Proteins | ||
ECSIT-7177H | Recombinant Human ECSIT Homolog (Drosophila), His-tagged | +Inquiry |
ECSIT-3038H | Recombinant Human ECSIT Protein, GST-tagged | +Inquiry |
ECSIT-4976M | Recombinant Mouse ECSIT Protein | +Inquiry |
ECSIT-6084H | Recombinant Human ECSIT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ecsit-2721M | Recombinant Mouse Ecsit Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECSIT-241HCL | Recombinant Human ECSIT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECSIT Products
Required fields are marked with *
My Review for All ECSIT Products
Required fields are marked with *
0
Inquiry Basket