Recombinant Human ECSIT protein, His-tagged
| Cat.No. : | ECSIT-3780H |
| Product Overview : | Recombinant Human ECSIT protein(49-267 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | June 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 49-267 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | SSEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ECSIT ECSIT homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | ECSIT |
| Synonyms | ECSIT; ECSIT homolog (Drosophila); evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial; signaling intermediate in Toll pathway evolutionarily conserved ortholog (mouse); SITPEC; likely ortholog of mouse signaling intermediate in Toll pathway evolutionarily conserved; |
| Gene ID | 51295 |
| mRNA Refseq | NM_001142464 |
| Protein Refseq | NP_001135936 |
| MIM | 608388 |
| UniProt ID | Q9BQ95 |
| ◆ Recombinant Proteins | ||
| ECSIT-922H | Recombinant Human ECSIT Protein, MYC/DDK-tagged | +Inquiry |
| ECSIT-1664R | Recombinant Rat ECSIT Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECSIT-7177H | Recombinant Human ECSIT Homolog (Drosophila), His-tagged | +Inquiry |
| ECSIT-2631M | Recombinant Mouse ECSIT Protein, His (Fc)-Avi-tagged | +Inquiry |
| ECSIT-3038H | Recombinant Human ECSIT Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ECSIT-241HCL | Recombinant Human ECSIT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECSIT Products
Required fields are marked with *
My Review for All ECSIT Products
Required fields are marked with *
