Recombinant Human ECSIT protein, His-tagged

• Cat.No.: ECSIT-3780H
• Product Overview: Recombinant Human ECSIT protein(49-267 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 49-267 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: SSEQSLVPSPPEPRQRPTKALVPFEDLFGQAPGGERDKASFLQTVQKFAEHSVRKRGHIDFIYLALRKMREYGVERDLAVYNQLLNIFPKEVFRPRNIIQRIFVHYPRQQECGIAVLEQMENHGVMPNKETEFLLIQIFGRKSYPMLKLVRLKLWFPRFMNVNPFPVPRDLPQDPVELAMFGLRHMEPDLSARVTIYQVPLPKDSTGAADPPQPHIVGS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ECSIT ECSIT homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: ECSIT
• Synonyms: ECSIT; ECSIT homolog (Drosophila); evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial; signaling intermediate in Toll pathway evolutionarily conserved ortholog (mouse); SITPEC; likely ortholog of mouse signaling intermediate in Toll pathway evolutionarily conserved
• Gene ID: 51295
• mRNA Refseq: NM_001142464
• Protein Refseq: NP_001135936
• MIM: 608388
• UniProt ID: Q9BQ95