Recombinant Human EDAR Protein, GST-tagged
Cat.No. : | EDAR-3049H |
Product Overview : | Human EDAR partial ORF ( NP_071731, 64 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 38.39 kDa |
AA Sequence : | TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EDAR ectodysplasin A receptor [ Homo sapiens ] |
Official Symbol | EDAR |
Synonyms | EDAR; ectodysplasin A receptor; DL, ectodysplasin 1, anhidrotic receptor , ED3; tumor necrosis factor receptor superfamily member EDAR; ED1R; ED5; EDA1R; EDA3; Edar; EDA-A1 receptor; downless homolog; ectodysplasin-A receptor; downless, mouse, homolog of; ectodermal dysplasia receptor; anhidrotic ectodysplasin receptor 1; ectodysplasin 1, anhidrotic receptor; DL; ED3; HRM1; EDA-A1R; FLJ94390; |
Gene ID | 10913 |
mRNA Refseq | NM_022336 |
Protein Refseq | NP_071731 |
MIM | 604095 |
UniProt ID | Q9UNE0 |
◆ Recombinant Proteins | ||
Edar-2723M | Recombinant Mouse Edar Protein, Myc/DDK-tagged | +Inquiry |
EDAR-3135H | Recombinant Human EDAR protein(Met1-Ile189), hFc-tagged | +Inquiry |
EDAR-606H | Recombinant Human ectodysplasin A receptor, His-tagged | +Inquiry |
EDAR-1402H | Recombinant Human EDAR Protein, His-tagged | +Inquiry |
EDAR-3215H | Recombinant Human EDAR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDAR-1021CCL | Recombinant Cynomolgus EDAR cell lysate | +Inquiry |
EDAR-1537RCL | Recombinant Rat EDAR cell lysate | +Inquiry |
EDAR-2247HCL | Recombinant Human EDAR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDAR Products
Required fields are marked with *
My Review for All EDAR Products
Required fields are marked with *
0
Inquiry Basket