Recombinant Human EDAR Protein, GST-tagged

Cat.No. : EDAR-3049H
Product Overview : Human EDAR partial ORF ( NP_071731, 64 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]
Molecular Mass : 38.39 kDa
AA Sequence : TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EDAR ectodysplasin A receptor [ Homo sapiens ]
Official Symbol EDAR
Synonyms EDAR; ectodysplasin A receptor; DL, ectodysplasin 1, anhidrotic receptor , ED3; tumor necrosis factor receptor superfamily member EDAR; ED1R; ED5; EDA1R; EDA3; Edar; EDA-A1 receptor; downless homolog; ectodysplasin-A receptor; downless, mouse, homolog of; ectodermal dysplasia receptor; anhidrotic ectodysplasin receptor 1; ectodysplasin 1, anhidrotic receptor; DL; ED3; HRM1; EDA-A1R; FLJ94390;
Gene ID 10913
mRNA Refseq NM_022336
Protein Refseq NP_071731
MIM 604095
UniProt ID Q9UNE0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDAR Products

Required fields are marked with *

My Review for All EDAR Products

Required fields are marked with *

0
cart-icon