Recombinant Human EDEM1 Protein, GST-tagged

Cat.No. : EDEM1-3050H
Product Overview : Human EDEM1 partial ORF ( NP_055489.1, 559 a.a. - 656 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EDEM1 (ER Degradation Enhancing Alpha-Mannosidase Like Protein 1) is a Protein Coding gene. Among its related pathways are Calnexin/calreticulin cycle and Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF). GO annotations related to this gene include calcium ion binding and mannosyl-oligosaccharide 1,2-alpha-mannosidase activity. An important paralog of this gene is EDEM2.
Molecular Mass : 36.52 kDa
AA Sequence : YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EDEM1 ER degradation enhancer, mannosidase alpha-like 1 [ Homo sapiens ]
Official Symbol EDEM1
Synonyms EDEM1; ER degradation enhancer, mannosidase alpha-like 1; ER degradation-enhancing alpha-mannosidase-like 1; EDEM; KIAA0212; FLJ51559; FLJ51560;
Gene ID 9695
mRNA Refseq NM_014674
Protein Refseq NP_055489
MIM 607673
UniProt ID Q92611

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDEM1 Products

Required fields are marked with *

My Review for All EDEM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon