Recombinant Human EDEM1 Protein, GST-tagged
Cat.No. : | EDEM1-3050H |
Product Overview : | Human EDEM1 partial ORF ( NP_055489.1, 559 a.a. - 656 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EDEM1 (ER Degradation Enhancing Alpha-Mannosidase Like Protein 1) is a Protein Coding gene. Among its related pathways are Calnexin/calreticulin cycle and Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF). GO annotations related to this gene include calcium ion binding and mannosyl-oligosaccharide 1,2-alpha-mannosidase activity. An important paralog of this gene is EDEM2. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EDEM1 ER degradation enhancer, mannosidase alpha-like 1 [ Homo sapiens ] |
Official Symbol | EDEM1 |
Synonyms | EDEM1; ER degradation enhancer, mannosidase alpha-like 1; ER degradation-enhancing alpha-mannosidase-like 1; EDEM; KIAA0212; FLJ51559; FLJ51560; |
Gene ID | 9695 |
mRNA Refseq | NM_014674 |
Protein Refseq | NP_055489 |
MIM | 607673 |
UniProt ID | Q92611 |
◆ Recombinant Proteins | ||
EDEM1-2637M | Recombinant Mouse EDEM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EDEM1-3050H | Recombinant Human EDEM1 Protein, GST-tagged | +Inquiry |
EDEM1-11406Z | Recombinant Zebrafish EDEM1 | +Inquiry |
EDEM1-1295C | Recombinant Chicken EDEM1 | +Inquiry |
EDEM1-4986M | Recombinant Mouse EDEM1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDEM1 Products
Required fields are marked with *
My Review for All EDEM1 Products
Required fields are marked with *