Recombinant Human EDF1, His-tagged

• Cat.No.: EDF1-28461TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-148 of Human EDF1 with N terminal His tag, 25kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-148 a.a.
• Description: This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene.
• Conjugation: HIS
• Tissue specificity: Expressed in brain, liver, lung, kidney and heart (at protein level). Ubiquitously expressed. More abundant in heart, pancreas, liver, intestine and adipose tissues.
• Form: Lyophilised:Reconstitute with 48 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Store at 4°C. Upon reconstitution store at -80oC.
• Sequences of amino acids: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVET SKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVG KVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNN QVLGKIERAIGLKLRGKDIGKPIEKGPRAK
• Sequence Similarities: Contains 1 HTH cro/C1-type DNA-binding domain.
• Full Length: Full L.

Gene Information

• Gene Name: EDF1 endothelial differentiation-related factor 1 [ Homo sapiens ]
• Official Symbol: EDF1
• Synonyms: EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1
• Gene ID: 8721
• mRNA Refseq: NM_003792
• Protein Refseq: NP_003783
• MIM: 605107
• Uniprot ID: O60869
• Chromosome Location: 9q34.3
• Function: calmodulin binding; NOT histone acetyltransferase activity; NOT methyltransferase activity; protein binding; sequence-specific DNA binding