Recombinant Human EDF1, His-tagged
Cat.No. : | EDF1-28461TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-148 of Human EDF1 with N terminal His tag, 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-148 a.a. |
Description : | This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Expressed in brain, liver, lung, kidney and heart (at protein level). Ubiquitously expressed. More abundant in heart, pancreas, liver, intestine and adipose tissues. |
Form : | Lyophilised:Reconstitute with 48 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVET SKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVG KVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNN QVLGKIERAIGLKLRGKDIGKPIEKGPRAK |
Sequence Similarities : | Contains 1 HTH cro/C1-type DNA-binding domain. |
Full Length : | Full L. |
Gene Name | EDF1 endothelial differentiation-related factor 1 [ Homo sapiens ] |
Official Symbol | EDF1 |
Synonyms | EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; |
Gene ID | 8721 |
mRNA Refseq | NM_003792 |
Protein Refseq | NP_003783 |
MIM | 605107 |
Uniprot ID | O60869 |
Chromosome Location | 9q34.3 |
Function | calmodulin binding; NOT histone acetyltransferase activity; NOT methyltransferase activity; protein binding; sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
EDF1-4188HF | Recombinant Full Length Human EDF1 Protein, GST-tagged | +Inquiry |
EDF1-1352C | Recombinant Chicken EDF1 | +Inquiry |
EDF1-2258H | Recombinant Human EDF1 Protein (Ala2-Lys148), C-His tagged | +Inquiry |
EDF1-3052H | Recombinant Human EDF1 Protein, GST-tagged | +Inquiry |
EDF1-525H | Recombinant Human EDF1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDF1-6723HCL | Recombinant Human EDF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDF1 Products
Required fields are marked with *
My Review for All EDF1 Products
Required fields are marked with *
0
Inquiry Basket