Recombinant Human EDF1 protein, GST-tagged

Cat.No. : EDF1-12280H
Product Overview : Recombinant Human EDF1 protein(1-148 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-148 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol EDF1
Synonyms EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; MBF1; EDF-1; MGC9058;
Gene ID 8721
mRNA Refseq NM_003792
Protein Refseq NP_003783
MIM 605107
UniProt ID O60869

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDF1 Products

Required fields are marked with *

My Review for All EDF1 Products

Required fields are marked with *

0
cart-icon