Recombinant Human EDF1 protein, GST-tagged
Cat.No. : | EDF1-12280H |
Product Overview : | Recombinant Human EDF1 protein(1-148 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-148 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | EDF1 |
Synonyms | EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; MBF1; EDF-1; MGC9058; |
Gene ID | 8721 |
mRNA Refseq | NM_003792 |
Protein Refseq | NP_003783 |
MIM | 605107 |
UniProt ID | O60869 |
◆ Recombinant Proteins | ||
EDF1-4188HF | Recombinant Full Length Human EDF1 Protein, GST-tagged | +Inquiry |
EDF1-6774H | Recombinant Human EDF1 protein | +Inquiry |
EDF1-2704H | Recombinant Human EDF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EDF1-1379R | Recombinant Rhesus monkey EDF1 Protein, His-tagged | +Inquiry |
EDF1-11008Z | Recombinant Zebrafish EDF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDF1-6723HCL | Recombinant Human EDF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDF1 Products
Required fields are marked with *
My Review for All EDF1 Products
Required fields are marked with *
0
Inquiry Basket