Recombinant Human EDF1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EDF1-2704H |
Product Overview : | EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 16.4 kDa |
AA Sequence : | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EDF1 endothelial differentiation-related factor 1 [ Homo sapiens (human) ] |
Official Symbol | EDF1 |
Synonyms | EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; MBF1; EDF-1; MGC9058; |
Gene ID | 8721 |
mRNA Refseq | NM_003792 |
Protein Refseq | NP_003783 |
MIM | 605107 |
UniProt ID | O60869 |
◆ Recombinant Proteins | ||
EDF1-525H | Recombinant Human EDF1 Protein, His-tagged | +Inquiry |
EDF1-2774H | Recombinant Human EDF1, His-tagged | +Inquiry |
EDF1-2704H | Recombinant Human EDF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EDF1-1379R | Recombinant Rhesus monkey EDF1 Protein, His-tagged | +Inquiry |
EDF1-3052H | Recombinant Human EDF1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDF1-6723HCL | Recombinant Human EDF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDF1 Products
Required fields are marked with *
My Review for All EDF1 Products
Required fields are marked with *