Recombinant Human EDN1 protein, His-tagged
| Cat.No. : | EDN1-3023H |
| Product Overview : | Recombinant Human EDN1 protein(1-212 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-212 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EDN1 endothelin 1 [ Homo sapiens ] |
| Official Symbol | EDN1 |
| Synonyms | EDN1; endothelin 1; endothelin-1; ET1; preproendothelin-1; PPET1; HDLCQ7; |
| Gene ID | 1906 |
| mRNA Refseq | NM_001168319 |
| Protein Refseq | NP_001161791 |
| UniProt ID | P05305 |
| ◆ Recombinant Proteins | ||
| EDN1-2804R | Recombinant Rabbit EDN1 Protein, His-tagged, BSA Conjugated | +Inquiry |
| EDN1-35H | Recombinant Human EDN1 protein, His-tagged | +Inquiry |
| EDN1-2026H | Recombinant Human EDN1 Protein (Ala18-Trp212), His tagged | +Inquiry |
| Edn1-2686R | Active Recombinant Rat Edn1 protein, His-tagged | +Inquiry |
| Edn1-2803M | Recombinant Mouse Edn1 Protein, His-tagged, BSA Conjugated | +Inquiry |
| ◆ Native Proteins | ||
| EDN1-8305H | Native Human EDN1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EDN1-6721HCL | Recombinant Human EDN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDN1 Products
Required fields are marked with *
My Review for All EDN1 Products
Required fields are marked with *
