Recombinant Human EDN1 protein, His-tagged
Cat.No. : | EDN1-3023H |
Product Overview : | Recombinant Human EDN1 protein(1-212 aa), fused to His tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-212 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EDN1 endothelin 1 [ Homo sapiens ] |
Official Symbol | EDN1 |
Synonyms | EDN1; endothelin 1; endothelin-1; ET1; preproendothelin-1; PPET1; HDLCQ7; |
Gene ID | 1906 |
mRNA Refseq | NM_001168319 |
Protein Refseq | NP_001161791 |
UniProt ID | P05305 |
◆ Recombinant Proteins | ||
EDN1-4991M | Recombinant Mouse EDN1 Protein | +Inquiry |
Edn1-2729M | Recombinant Mouse Edn1 Protein, Myc/DDK-tagged | +Inquiry |
EDN1-2026H | Recombinant Human EDN1 Protein (Ala18-Trp212), His tagged | +Inquiry |
Edn1-594M | Recombinant Mouse Edn1 protein, His-tagged | +Inquiry |
EDN1-35H | Recombinant Human EDN1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
EDN1-8305H | Native Human EDN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDN1-6721HCL | Recombinant Human EDN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDN1 Products
Required fields are marked with *
My Review for All EDN1 Products
Required fields are marked with *
0
Inquiry Basket