Recombinant Human EDNRB
Cat.No. : | EDNRB-28559TH |
Product Overview : | Recombinant fragment of Human Endothelin B Receptor with a N terminal proprietary tag: predicted molecular weight 33.88 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 75 amino acids |
Description : | The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 33.880kDa inclusive of tags |
Tissue specificity : | Expressed in placental stem villi vessels, but not in cultured placental villi smooth muscle cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRB sub-subfamily. |
Gene Name | EDNRB endothelin receptor type B [ Homo sapiens ] |
Official Symbol | EDNRB |
Synonyms | EDNRB; endothelin receptor type B; HSCR, HSCR2; endothelin B receptor; ETB; |
Gene ID | 1910 |
mRNA Refseq | NM_000115 |
Protein Refseq | NP_000106 |
MIM | 131244 |
Uniprot ID | P24530 |
Chromosome Location | 13q22 |
Pathway | Arf6 trafficking events, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Endothelins, organism-specific biosystem; |
Function | G-protein coupled receptor activity; endothelin receptor activity; endothelin receptor activity; endothelin receptor activity; peptide hormone binding; |
◆ Recombinant Proteins | ||
EDNRB-1669R | Recombinant Rat EDNRB Protein, His (Fc)-Avi-tagged | +Inquiry |
EDNRB-1209H | Recombinant Human EDNRB Protein, MYC/DDK-tagged | +Inquiry |
RFL985EF | Recombinant Full Length Horse Endothelin B Receptor(Ednrb) Protein, His-Tagged | +Inquiry |
RFL26513OF | Recombinant Full Length Rabbit Endothelin B Receptor(Ednrb) Protein, His-Tagged | +Inquiry |
EDNRB-28559TH | Recombinant Human EDNRB | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDNRB-001HCL | Recombinant Human EDNRB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDNRB Products
Required fields are marked with *
My Review for All EDNRB Products
Required fields are marked with *
0
Inquiry Basket