Recombinant Human EDNRB

• Cat.No.: EDNRB-28559TH
• Product Overview: Recombinant fragment of Human Endothelin B Receptor with a N terminal proprietary tag: predicted molecular weight 33.88 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 75 amino acids
• Description: The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 33.880kDa inclusive of tags
• Tissue specificity: Expressed in placental stem villi vessels, but not in cultured placental villi smooth muscle cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRB sub-subfamily.

Gene Information

• Gene Name: EDNRB endothelin receptor type B [ Homo sapiens ]
• Official Symbol: EDNRB
• Synonyms: EDNRB; endothelin receptor type B; HSCR, HSCR2; endothelin B receptor; ETB
• Gene ID: 1910
• mRNA Refseq: NM_000115
• Protein Refseq: NP_000106
• MIM: 131244
• Uniprot ID: P24530
• Chromosome Location: 13q22
• Pathway: Arf6 trafficking events, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Endothelins, organism-specific biosystem
• Function: G-protein coupled receptor activity; endothelin receptor activity; endothelin receptor activity; endothelin receptor activity; peptide hormone binding