Recombinant Human EDNRB protein, His-tagged
Cat.No. : | EDNRB-12286H |
Product Overview : | Recombinant Human EDNRB protein(27-99 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-99 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKET |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | EDNRB endothelin receptor type B [ Homo sapiens ] |
Official Symbol | EDNRB |
Synonyms | EDNRB; endothelin receptor type B; HSCR, HSCR2; endothelin B receptor; ETB; endothelin receptor non-selective type; ET-B; ETBR; ETRB; HSCR; WS4A; ABCDS; ET-BR; HSCR2; |
Gene ID | 1910 |
mRNA Refseq | NM_000115 |
Protein Refseq | NP_000106 |
MIM | 131244 |
UniProt ID | P24530 |
◆ Recombinant Proteins | ||
EDNRB-12286H | Recombinant Human EDNRB protein, His-tagged | +Inquiry |
EDNRB-1287H | Recombinant Human EDNRB protein, GST-tagged | +Inquiry |
RFL6232CF | Recombinant Full Length Dog Endothelin B Receptor(Ednrb) Protein, His-Tagged | +Inquiry |
EDNRB-272H | Recombinant Human EDNRB, Fc-tagged | +Inquiry |
RFL26513OF | Recombinant Full Length Rabbit Endothelin B Receptor(Ednrb) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDNRB-001HCL | Recombinant Human EDNRB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDNRB Products
Required fields are marked with *
My Review for All EDNRB Products
Required fields are marked with *