Recombinant Human EEF1AKMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: EEF1AKMT1-3861H
• Product Overview: N6AMT2 MS Standard C13 and N15-labeled recombinant protein (NP_777588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: EEF1AKMT1 (EEF1A Lysine Methyltransferase 1) is a Protein Coding gene. Among its related pathways are Protein methylation and Metabolism of proteins.
• Molecular Mass: 24.5 kDa
• AA Sequence: MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EEF1AKMT1 EEF1A lysine methyltransferase 1 [ Homo sapiens (human) ]
• Official Symbol: EEF1AKMT1
• Synonyms: EEF1AKMT1; EEF1A lysine methyltransferase 1; ESP13; N6AMT2; EEF1A lysine methyltransferase 1; N-6 adenine-specific DNA methyltransferase 2 (putative); eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1; n(6)-adenine-specific DNA methyltransferase 2; protein-lysine N-methyltransferase N6AMT2; EC 2.1.1.-
• Gene ID: 221143
• mRNA Refseq: NM_174928
• Protein Refseq: NP_777588
• MIM: 617793
• UniProt ID: Q8WVE0