Recombinant Human EEF1AKMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EEF1AKMT1-3861H |
Product Overview : | N6AMT2 MS Standard C13 and N15-labeled recombinant protein (NP_777588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | EEF1AKMT1 (EEF1A Lysine Methyltransferase 1) is a Protein Coding gene. Among its related pathways are Protein methylation and Metabolism of proteins. |
Molecular Mass : | 24.5 kDa |
AA Sequence : | MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EEF1AKMT1 EEF1A lysine methyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | EEF1AKMT1 |
Synonyms | EEF1AKMT1; EEF1A lysine methyltransferase 1; ESP13; N6AMT2; EEF1A lysine methyltransferase 1; N-6 adenine-specific DNA methyltransferase 2 (putative); eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1; n(6)-adenine-specific DNA methyltransferase 2; protein-lysine N-methyltransferase N6AMT2; EC 2.1.1.- |
Gene ID | 221143 |
mRNA Refseq | NM_174928 |
Protein Refseq | NP_777588 |
MIM | 617793 |
UniProt ID | Q8WVE0 |
◆ Recombinant Proteins | ||
EEF1AKMT1-1208H | Recombinant Human EEF1AKMT1 Protein, MYC/DDK-tagged | +Inquiry |
EEF1AKMT1-3861H | Recombinant Human EEF1AKMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Eef1akmt1-2734M | Recombinant Mouse Eef1akmt1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1AKMT1 Products
Required fields are marked with *
My Review for All EEF1AKMT1 Products
Required fields are marked with *