Recombinant Human EEF1AKMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EEF1AKMT1-3861H
Product Overview : N6AMT2 MS Standard C13 and N15-labeled recombinant protein (NP_777588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : EEF1AKMT1 (EEF1A Lysine Methyltransferase 1) is a Protein Coding gene. Among its related pathways are Protein methylation and Metabolism of proteins.
Molecular Mass : 24.5 kDa
AA Sequence : MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EEF1AKMT1 EEF1A lysine methyltransferase 1 [ Homo sapiens (human) ]
Official Symbol EEF1AKMT1
Synonyms EEF1AKMT1; EEF1A lysine methyltransferase 1; ESP13; N6AMT2; EEF1A lysine methyltransferase 1; N-6 adenine-specific DNA methyltransferase 2 (putative); eukaryotic translation elongation factor 1 alpha lysine methyltransferase 1; n(6)-adenine-specific DNA methyltransferase 2; protein-lysine N-methyltransferase N6AMT2; EC 2.1.1.-
Gene ID 221143
mRNA Refseq NM_174928
Protein Refseq NP_777588
MIM 617793
UniProt ID Q8WVE0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EEF1AKMT1 Products

Required fields are marked with *

My Review for All EEF1AKMT1 Products

Required fields are marked with *

0
cart-icon