Recombinant Human EEF1B2 protein, GST-tagged
| Cat.No. : | EEF1B2-12290H |
| Product Overview : | Recombinant Human EEF1B2 protein(1-225 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | June 26, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-225 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AASequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens ] |
| Official Symbol | EEF1B2 |
| Synonyms | EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1; EF1B; EEF1B; EEF1B1; |
| Gene ID | 1933 |
| mRNA Refseq | NM_001037663 |
| Protein Refseq | NP_001032752 |
| MIM | 600655 |
| UniProt ID | P24534 |
| ◆ Recombinant Proteins | ||
| EEF1B2-224C | Recombinant Cynomolgus Monkey EEF1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EEF1B2-4207HF | Recombinant Full Length Human EEF1B2 Protein, GST-tagged | +Inquiry |
| EEF1B2-1208R | Recombinant Rhesus Macaque EEF1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EEF1B2-5455H | Recombinant Human EEF1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EEF1B2-10315Z | Recombinant Zebrafish EEF1B2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1B2 Products
Required fields are marked with *
My Review for All EEF1B2 Products
Required fields are marked with *
