Recombinant Human EEF1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | EEF1B2-5212H |
| Product Overview : | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001032752) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. |
| Molecular Mass : | 24.8 kDa |
| AA Sequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens (human) ] |
| Official Symbol | EEF1B2 |
| Synonyms | EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1; EF1B; EEF1B; EEF1B1; |
| Gene ID | 1933 |
| mRNA Refseq | NM_001037663 |
| Protein Refseq | NP_001032752 |
| MIM | 600655 |
| UniProt ID | P24534 |
| ◆ Recombinant Proteins | ||
| Eef1b2-2736M | Recombinant Mouse Eef1b2 Protein, Myc/DDK-tagged | +Inquiry |
| EEF1B2-460HFL | Active Recombinant Full Length Human EEF1B2 Protein, C-Flag-tagged | +Inquiry |
| EEF1B2-5212H | Recombinant Human EEF1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EEF1B2-365H | Recombinant Human EEF1B2 protein, His-tagged | +Inquiry |
| EEF1B2-2647M | Recombinant Mouse EEF1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1B2 Products
Required fields are marked with *
My Review for All EEF1B2 Products
Required fields are marked with *
