Recombinant Human EEF1G, His-tagged
| Cat.No. : | EEF1G-27778TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 2-437 of Human EEF1G with N terminal His tag. Predicted MWt 50kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-437 a.a. |
| Description : | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. |
| Conjugation : | HIS |
| Tissue specificity : | Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver. |
| Form : | Lyophilised:Reconstitute with 113 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFG QTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV SNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPT LGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERV TLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCI NQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRK EKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFW EHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRL DKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLS PDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVG KAFNQGKIFK |
| Sequence Similarities : | Contains 1 EF-1-gamma C-terminal domain.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain. |
| Full Length : | Full L. |
| Gene Name | EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens ] |
| Official Symbol | EEF1G |
| Synonyms | EEF1G; eukaryotic translation elongation factor 1 gamma; elongation factor 1-gamma; EF1G; |
| Gene ID | 1937 |
| mRNA Refseq | NM_001404 |
| Protein Refseq | NP_001395 |
| MIM | 130593 |
| Uniprot ID | P26641 |
| Chromosome Location | 11q12.3 |
| Pathway | Eukaryotic Translation Elongation, organism-specific biosystem; Gene Expression, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; Metabolism of proteins, organism-specific biosystem; |
| Function | protein binding; translation elongation factor activity; |
| ◆ Recombinant Proteins | ||
| Eef1g-2738M | Recombinant Mouse Eef1g Protein, Myc/DDK-tagged | +Inquiry |
| EEF1G-1673R | Recombinant Rat EEF1G Protein, His (Fc)-Avi-tagged | +Inquiry |
| EEF1G-2016R | Recombinant Rat EEF1G Protein | +Inquiry |
| EEF1G-3074H | Recombinant Human EEF1G Protein, GST-tagged | +Inquiry |
| EEF1G-4210HF | Recombinant Full Length Human EEF1G Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EEF1G-6712HCL | Recombinant Human EEF1G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1G Products
Required fields are marked with *
My Review for All EEF1G Products
Required fields are marked with *
