Recombinant Human EFCAB1 Protein, GST-tagged

• Cat.No.: EFCAB1-3079H
• Product Overview: Human EFCAB1 full-length ORF ( NP_078869.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EFCAB1 (EF-Hand Calcium Binding Domain 1) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding.
• Molecular Mass: 50.9 kDa
• AA Sequence: MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EFCAB1 EF-hand calcium binding domain 1 [ Homo sapiens ]
• Official Symbol: EFCAB1
• Synonyms: EFCAB1; EF-hand calcium binding domain 1; EF-Hand Calcium Binding Domain 1; EF-hand calcium-binding domain-containing protein 1
• Gene ID: 79645
• mRNA Refseq: NM_024593
• Protein Refseq: NP_078869
• UniProt ID: Q9HAE3