Recombinant Human EFCAB1 Protein, GST-tagged
| Cat.No. : | EFCAB1-3079H |
| Product Overview : | Human EFCAB1 full-length ORF ( NP_078869.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | EFCAB1 (EF-Hand Calcium Binding Domain 1) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. |
| Molecular Mass : | 50.9 kDa |
| AA Sequence : | MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EFCAB1 EF-hand calcium binding domain 1 [ Homo sapiens ] |
| Official Symbol | EFCAB1 |
| Synonyms | EFCAB1; EF-hand calcium binding domain 1; EF-Hand Calcium Binding Domain 1; EF-hand calcium-binding domain-containing protein 1 |
| Gene ID | 79645 |
| mRNA Refseq | NM_024593 |
| Protein Refseq | NP_078869 |
| UniProt ID | Q9HAE3 |
| ◆ Recombinant Proteins | ||
| EFCAB1-500H | Recombinant Human EFCAB1 protein, His-tagged | +Inquiry |
| Efcab1-2741M | Recombinant Mouse Efcab1 Protein, Myc/DDK-tagged | +Inquiry |
| EFCAB1-5008M | Recombinant Mouse EFCAB1 Protein | +Inquiry |
| EFCAB1-4222HF | Recombinant Full Length Human EFCAB1 Protein, GST-tagged | +Inquiry |
| EFCAB1-1387R | Recombinant Rhesus monkey EFCAB1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFCAB1-6710HCL | Recombinant Human EFCAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFCAB1 Products
Required fields are marked with *
My Review for All EFCAB1 Products
Required fields are marked with *
