Recombinant Human EFNA1 protein, GST-tagged
| Cat.No. : | EFNA1-301377H |
| Product Overview : | Recombinant Human EFNA1 (56-105 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Asp56-Ser105 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | DHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | EFNA1 ephrin-A1 [ Homo sapiens ] |
| Official Symbol | EFNA1 |
| Synonyms | EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4; B61; EFL1; EPLG1; LERK-1; TNFAIP4; |
| Gene ID | 1942 |
| mRNA Refseq | NM_004428 |
| Protein Refseq | NP_004419 |
| MIM | 191164 |
| UniProt ID | P20827 |
| ◆ Recombinant Proteins | ||
| Efna1-3314M | Active Recombinant Mouse Efna1 protein(Met1-Ser182), His-tagged | +Inquiry |
| EFNA1-1681R | Recombinant Rat EFNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EFNA1-3265H | Recombinant Human EFNA1 Protein (Asp19-Ser182), C-His tagged | +Inquiry |
| Efna1-2753M | Recombinant Mouse Efna1 Protein, Myc/DDK-tagged | +Inquiry |
| Efna1-425M | Active Recombinant Mouse Ephrin A1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFNA1-2177MCL | Recombinant Mouse EFNA1 cell lysate | +Inquiry |
| EFNA1-150HKCL | Human EFNA1 Knockdown Cell Lysate | +Inquiry |
| EFNA1-1514RCL | Recombinant Rat EFNA1 cell lysate | +Inquiry |
| EFNA1-2594HCL | Recombinant Human EFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA1 Products
Required fields are marked with *
My Review for All EFNA1 Products
Required fields are marked with *
