"EFNA1" Related Products

Expand
Expand

Recombinant Human EFNA1 Protein, His-tagged

Cat.No. : EFNA1-357H
Product Overview : Recombinant Human EFNA1(Asp19-Ser182) fused with His tag at the C-terminus was produced in HEK293.
Description : Ephrin-A1 is a member of the A-type ephrin family of cell surface proteins that function as ligands for the A-type Eph receptor tyrosine kinase family. Ephrin-A1 can be induced by TNF and IL1B. Its expression levels can be down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells. Soluble Ephrin-A1 is necessary for the transformation of HeLa and SK-BR3 cells and participates in the relocalization of EPHA2 away from sites of cell-cell contact during transformation. Ephrin-A1 plays an important role in angiogenesis and tumor neovascularization.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Protein length : Asp19-Ser182
AA sequence : DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQ SKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVS GKITHSPQAHVNPQEKRLAADDPEVRVLHSIAHSVDHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Figure :

Gene Name : EFNA1 ephrin-A1 [ Homo sapiens ]
Official Symbol : EFNA1
Synonyms : EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4; B61; EFL1; EPLG1; LERK-1; TNFAIP4;
Gene ID : 1942
mRNA Refseq : NM_004428
Protein Refseq : NP_004419
MIM : 191164
UniProt ID : P20827

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.