Recombinant Human EFNA2

• Cat.No.: EFNA2-28624TH
• Product Overview: Recombinant full length Human Ephrin A2 with N-terminal proprietary tag. Predicted MW 50.43kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 213 amino acids
• Description: This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
• Molecular Weight: 50.430kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
• Sequence Similarities: Belongs to the ephrin family.

Gene Information

• Gene Name: EFNA2 ephrin-A2 [ Homo sapiens ]
• Official Symbol: EFNA2
• Synonyms: EFNA2; ephrin-A2; EPLG6; ELF 1; LERK6
• Gene ID: 1943
• mRNA Refseq: NM_001405
• Protein Refseq: NP_001396
• MIM: 602756
• Uniprot ID: O43921
• Chromosome Location: 19p13
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem
• Function: ephrin receptor binding