Recombinant Human EFNA5 Protein, hIgG/His-tagged

Cat.No. : EFNA5-16H
Product Overview : Recombinant human Ephrin-A5 (21-203aa, 422aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 21-203
Form : Liquid
Molecular Mass : 48.1 kDa
AA Sequence : QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name EFNA5 ephrin A5 [ Homo sapiens (human) ]
Official Symbol EFNA5
Synonyms EFNA5; ephrin A5; AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7; ephrin-A5; AL-1; LERK-7; eph-related receptor tyrosine kinase ligand 7
Gene ID 1946
mRNA Refseq NM_001962
Protein Refseq NP_001953
MIM 601535
UniProt ID P52803

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA5 Products

Required fields are marked with *

My Review for All EFNA5 Products

Required fields are marked with *

0
cart-icon
0
compare icon