Recombinant Human EFNA5 Protein, hIgG/His-tagged
| Cat.No. : | EFNA5-16H |
| Product Overview : | Recombinant human Ephrin-A5 (21-203aa, 422aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
| Availability | November 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | Fc&His |
| Protein Length : | 21-203 |
| Form : | Liquid |
| Molecular Mass : | 48.1 kDa |
| AA Sequence : | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | EFNA5 ephrin A5 [ Homo sapiens (human) ] |
| Official Symbol | EFNA5 |
| Synonyms | EFNA5; ephrin A5; AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7; ephrin-A5; AL-1; LERK-7; eph-related receptor tyrosine kinase ligand 7 |
| Gene ID | 1946 |
| mRNA Refseq | NM_001962 |
| Protein Refseq | NP_001953 |
| MIM | 601535 |
| UniProt ID | P52803 |
| ◆ Recombinant Proteins | ||
| EFNA5-1682R | Recombinant Rat EFNA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EFNA5-2025R | Recombinant Rat EFNA5 Protein | +Inquiry |
| EFNA5-3006H | Recombinant Human EFNA5 Protein (Gln21-Asn203), C-Fc tagged | +Inquiry |
| EFNA5-4397H | Recombinant Human EFNA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Efna5-29M | Recombinant Mouse Efna5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFNA5-2156MCL | Recombinant Mouse EFNA5 cell lysate | +Inquiry |
| EFNA5-993CCL | Recombinant Canine EFNA5 cell lysate | +Inquiry |
| EFNA5-1430CCL | Recombinant Cynomolgus EFNA5 cell lysate | +Inquiry |
| EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
| EFNA5-2734HCL | Recombinant Human EFNA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA5 Products
Required fields are marked with *
My Review for All EFNA5 Products
Required fields are marked with *
