Recombinant Human EFNA5 Protein, hIgG/His-tagged

• Cat.No.: EFNA5-16H
• Product Overview: Recombinant human Ephrin-A5 (21-203aa, 422aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: Fc&His
• Protein Length: 21-203
• Form: Liquid
• Molecular Mass: 48.1 kDa
• AA Sequence: QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: EFNA5 ephrin A5 [ Homo sapiens (human) ]
• Official Symbol: EFNA5
• Synonyms: EFNA5; ephrin A5; AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7; ephrin-A5; AL-1; LERK-7; eph-related receptor tyrosine kinase ligand 7
• Gene ID: 1946
• mRNA Refseq: NM_001962
• Protein Refseq: NP_001953
• MIM: 601535
• UniProt ID: P52803