Recombinant Human EGFL6 Protein, GST-tagged

Cat.No. : EGFL6-3114H
Product Overview : Human EGFL6 partial ORF ( AAH38587, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the epidermal growth factor (EGF) repeat superfamily. Members of this superfamily are characterized by the presence of EGF-like repeats and are often involved in the regulation of cell cycle, proliferation, and developmental processes. The gene product contains a signal peptide, suggesting that it is secreted; an EGF repeat region consisting of 4 complete EGF-like repeats and 1 partial EGF-like repeat, 3 of which have a calcium-binding consensus sequence; an arg-gly-asp integrin association motif; and a MAM domain, which is believed to have an adhesive function. This gene is expressed early during development, and its expression has been detected in lung and meningioma tumors. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : GFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EGFL6 EGF like domain multiple 6 [ Homo sapiens (human) ]
Official Symbol EGFL6
Synonyms EGFL6; EGF like domain multiple 6; EGF Like Domain Multiple 6; MAM And EGF Domains-Containing Gene Protein; MAM And EGF Domain Containing; EGF-Like Protein 6; MAEG; Epidermal Growth Factor-Like Protein 6; EGF Repeat-Containing Protein 6; EGF-Like-Domain, Multiple 6; W80; epidermal growth factor-like protein 6; EGF repeat-containing protein 6; EGF-like protein 6; MAM and EGF domain containing; MAM and EGF domains-containing gene protein
Gene ID 25975
mRNA Refseq NM_001167890
Protein Refseq NP_001161362
MIM 300239
UniProt ID Q8IUX8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGFL6 Products

Required fields are marked with *

My Review for All EGFL6 Products

Required fields are marked with *

0
cart-icon