Recombinant Human EGFL6 Protein, GST-tagged
Cat.No. : | EGFL6-3114H |
Product Overview : | Human EGFL6 partial ORF ( AAH38587, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the epidermal growth factor (EGF) repeat superfamily. Members of this superfamily are characterized by the presence of EGF-like repeats and are often involved in the regulation of cell cycle, proliferation, and developmental processes. The gene product contains a signal peptide, suggesting that it is secreted; an EGF repeat region consisting of 4 complete EGF-like repeats and 1 partial EGF-like repeat, 3 of which have a calcium-binding consensus sequence; an arg-gly-asp integrin association motif; and a MAM domain, which is believed to have an adhesive function. This gene is expressed early during development, and its expression has been detected in lung and meningioma tumors. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | GFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EGFL6 EGF like domain multiple 6 [ Homo sapiens (human) ] |
Official Symbol | EGFL6 |
Synonyms | EGFL6; EGF like domain multiple 6; EGF Like Domain Multiple 6; MAM And EGF Domains-Containing Gene Protein; MAM And EGF Domain Containing; EGF-Like Protein 6; MAEG; Epidermal Growth Factor-Like Protein 6; EGF Repeat-Containing Protein 6; EGF-Like-Domain, Multiple 6; W80; epidermal growth factor-like protein 6; EGF repeat-containing protein 6; EGF-like protein 6; MAM and EGF domain containing; MAM and EGF domains-containing gene protein |
Gene ID | 25975 |
mRNA Refseq | NM_001167890 |
Protein Refseq | NP_001161362 |
MIM | 300239 |
UniProt ID | Q8IUX8 |
◆ Recombinant Proteins | ||
Egfl6-996M | Recombinant Mouse Egfl6 Protein, Fc-tagged | +Inquiry |
EGFL6-5106C | Recombinant Chicken EGFL6 | +Inquiry |
EGFL6-22H | Active Recombinant Human EGFL6 Protein, His-tagged | +Inquiry |
EGFL6-588Z | Recombinant Zebrafish EGFL6 | +Inquiry |
EGFL6-447H | Active Recombinant Human EGFL6 Protein (Asn22-Asp553), His-FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFL6-001HCL | Recombinant Human EGFL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFL6 Products
Required fields are marked with *
My Review for All EGFL6 Products
Required fields are marked with *
0
Inquiry Basket