Recombinant Human EGFR, Fc-tagged EGFR-28395TH

Recombinant Human EGFR, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human EGFR, Fc-tagged

Recombinant Human EGFR, Fc-tagged Online Inquiry

EGFR Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : EGFR-28395TH Optional Service: Optional requirements on this protein
Product Overview : Recombinant fragment, corresponding to extracellular domain amino acids 25-525 of Human EGFR fused to the Fc region of Human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells.
Description : The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.
Conjugation : Fc
Tissue specificity : Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers.
Biological activity : The ED50 of EGFR-28395TH is typically 60-100 ng/ml as measured by its ability to neutralize EGF mediated proliferation of murine NIH3T3 fibroblasts.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical sequence:LEEKKVCQGTSNKLTQLGTFEDHFLSLQR MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLI ALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANK TGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENC QKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRE SDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEG KYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEED GVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVK EITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFS LAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTI NWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE GCWGPEPRDCVSRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.Contains 1 protein kinase domain.
Gene Name : EGFR epidermal growth factor receptor [ Homo sapiens ]
Official Symbol : EGFR
Synonyms : EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian);
Gene ID : 1956
mRNA Refseq : NM_005228
Protein Refseq : NP_005219
MIM : 131550
Uniprot ID : P00533
Chromosome Location : 7p12
Pathway : Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem;
Function : ATP binding; MAP/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2022 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy