Recombinant Human EGFR, Fc-tagged
Cat.No. : | EGFR-28395TH |
Product Overview : | Recombinant fragment, corresponding to extracellular domain amino acids 25-525 of Human EGFR fused to the Fc region of Human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Fc |
Protein Length : | 25-525 a.a. |
Description : | The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene. |
Conjugation : | Fc |
Tissue specificity : | Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers. |
Biological activity : | The ED50 of EGFR-28395TH is typically 60-100 ng/ml as measured by its ability to neutralize EGF mediated proliferation of murine NIH3T3 fibroblasts. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical sequence:LEEKKVCQGTSNKLTQLGTFEDHFLSLQR MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLI ALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANK TGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENC QKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRE SDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEG KYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEED GVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVK EITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFS LAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTI NWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE GCWGPEPRDCVSRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Sequence Similarities : | Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.Contains 1 protein kinase domain. |
Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
Official Symbol | EGFR |
Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); |
Gene ID | 1956 |
mRNA Refseq | NM_005228 |
Protein Refseq | NP_005219 |
MIM | 131550 |
Uniprot ID | P00533 |
Chromosome Location | 7p12 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; |
Function | ATP binding; MAP/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding; |
◆ Recombinant Proteins | ||
EGFR-602H | Active Recombinant Human EGFR, Fc-tagged, Biotinylated | +Inquiry |
EGFR-60CAF647 | Recombinant Cynomolgus EGFR Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
EGFR-7046C | Recombinant Chicken EGFR | +Inquiry |
RFL26372GF | Recombinant Full Length Chicken Epidermal Growth Factor Receptor(Egfr) Protein, His-Tagged | +Inquiry |
EGFR-1227RF | Recombinant Monkey EGFR Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
0
Inquiry Basket