Recombinant Human EGFR, Fc-tagged

Cat.No. : EGFR-28395TH
Product Overview : Recombinant fragment, corresponding to extracellular domain amino acids 25-525 of Human EGFR fused to the Fc region of Human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Tag : Fc
Protein Length : 25-525 a.a.
Description : The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. Multiple alternatively spliced transcript variants that encode different protein isoforms have been found for this gene.
Conjugation : Fc
Tissue specificity : Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers.
Biological activity : The ED50 of EGFR-28395TH is typically 60-100 ng/ml as measured by its ability to neutralize EGF mediated proliferation of murine NIH3T3 fibroblasts.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical sequence:LEEKKVCQGTSNKLTQLGTFEDHFLSLQR MFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLI ALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANK TGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENC QKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRE SDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEG KYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEED GVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVK EITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFS LAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTI NWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPE GCWGPEPRDCVSRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.Contains 1 protein kinase domain.
Gene Name EGFR epidermal growth factor receptor [ Homo sapiens ]
Official Symbol EGFR
Synonyms EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian);
Gene ID 1956
mRNA Refseq NM_005228
Protein Refseq NP_005219
MIM 131550
Uniprot ID P00533
Chromosome Location 7p12
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem;
Function ATP binding; MAP/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding;

Nanofitin as a New Molecular-Imaging Agent for the Diagnosis of Epidermal Growth Factor Receptor Over-Expressing Tumors.

Journal: Bioconjugate chemistry    PubMed ID: 28825794    Data: 2017/10/9

Authors: Marine Goux, Guillaume Becker, André Luxen

Article Snippet:Anti-EGFR B10 Nanofitin.Anti-EGFR B10 Nanofitin.. Anti-EGFR Nanofitins were identified upon several rounds of ribosome display 29 using the recombinant extracellular domain of human EGFR fused to a Fc fragment (Creative BioMart) as a bait.. Fusion of anti-EGFR Nanofitins to Pe38-KDEL toxins allowed the evaluation of their internalization potential by monitoring IC50 of the constructs on A431 cells, in comparison to a negative control involving the anti-egg white lysozyme H4 Nanofitin 27,28,35–37 and referred hereafter as IrrNF (Fig. 2).Fusion of anti-EGFR Nanofitins to Pe38-KDEL toxins allowed the evaluation of their internalization potential by monitoring IC50 of the constructs on A431 cells, in comparison to a negative control involving the anti-egg white lysozyme H4 Nanofitin 27,28,35–37 and referred hereafter as IrrNF (Fig. 2).

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGFR Products

Required fields are marked with *

My Review for All EGFR Products

Required fields are marked with *

0
cart-icon