Recombinant Human EGFR protein(1071-1150 aa), C-His-tagged
| Cat.No. : | EGFR-2500H |
| Product Overview : | Recombinant Human EGFR Protein (P00533, 1071-1150aa), was expressed in E. coli with C-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1071-1150 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNST |
| Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
| Official Symbol | EGFR |
| Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
| Gene ID | 1956 |
| mRNA Refseq | NM_005228 |
| Protein Refseq | NP_005219 |
| MIM | 131550 |
| UniProt ID | P00533 |
| ◆ Recombinant Proteins | ||
| EGFR-024H | Recombinant Human EGFR Protein, Fc-tagged | +Inquiry |
| EGFR-198H | Recombinant Human ABCB5 protein, DDK-tagged | +Inquiry |
| EGFR-100M | Active Recombinant Mouse EGFR Protein, His-tagged | +Inquiry |
| EGFR-206H | Recombinant Human EGFR, His-tagged | +Inquiry |
| EGFR-30H | Active Recombinant Human EGFR, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFR-151HKCL | Human EGFR Knockdown Cell Lysate | +Inquiry |
| EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
| EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
