Recombinant Human EGFR protein, Avi/His-tagged, Biotinylated
| Cat.No. : | EGFR-287H |
| Product Overview : | Recombinant Human EGFR Protein (25-645aa), was expressed in HEK293 with C-terminal Avi tag and His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Avi&His |
| Protein Length : | 25-645 aa |
| Description : | The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. The type III EGF deletion-mutant receptor (EGFRvIII) is the most common mutation and was first identified in primary human glioblastoma tumors; EGFR gene amplification is correlated with the structural rearrangement of the gene. The EGFRvIII gene has an in-frame deletion of 801 base pairs, corresponding to exons 2–7 in the mRNA, resulting in the deletion of amino acids 30-297 in the extracellular domain and the generation of a glycine at the fusion point |
| Predicted N Terminal : | Leu 25 |
| Form : | Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization. |
| Molecular Mass : | Has a calculated MW of 41.3 kDa. As a result of glycosylation, The protein migrates as 60-70 kDa under reducing (R) condition and 60-70 kDa under non-reducing (NR) condition on SDS-PAGE gel. |
| AA Sequence : | LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSGLNDIFEAQKIEWHEHHHHHH |
| Endotoxin : | Less than 1.0 EU per μg by the LAL method. |
| Purity : | >95% as determined by SDS-PAGE. |
| Storage : | For long term storage, the product should be stored at lyophilized state at -20 centigrade or lower. Please avoid repeated freeze-thaw cycles. No activity loss is observed after storage at: 4-8 centigrade for 12 months in lyophilized state; -70 centigrade for 3 months under sterile conditions after reconstitution. |
| Reconstitution : | Reconstitute at 200 μg/mL in sterile deionized water. |
| Conjugation : | Biotin |
| Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
| Official Symbol | EGFR |
| Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
| Gene ID | 1956 |
| mRNA Refseq | NM_005228 |
| Protein Refseq | NP_005219 |
| MIM | 131550 |
| UniProt ID | P00533 |
| Chromosome Location | 7p12 |
| Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bladder cancer, organism-specific biosystem; |
| Function | ATP binding; MAPK/ERK kinase kinase activity; actin filament binding; double-stranded DNA binding; enzyme binding; epidermal growth factor-activated receptor activity; epidermal growth factor-activated receptor activity; identical protein binding; contributes_to nitric-oxide synthase regulator activity; nucleotide binding; protein binding; protein heterodimerization activity; protein phosphatase binding; protein tyrosine kinase activity; protein tyrosine kinase activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; signal transducer activity; transmembrane receptor protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; transmembrane signaling receptor activity; |
| ◆ Recombinant Proteins | ||
| EGFR-2045H | Recombinant Human EGFR Protein (Leu25-Val30Gly, Asn298-Ser645), C-His tagged | +Inquiry |
| EGFR-P1001H | Recombinant HumanEpidermal Growth Factor Receptor | +Inquiry |
| EGFR-024HAF647 | Recombinant Human EGFR Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| EGFR-1369H | Recombinant Human EGFR Protein, DDK-tagged | +Inquiry |
| EGFR-101MAF488 | Recombinant Mouse EGFR Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-151HKCL | Human EGFR Knockdown Cell Lysate | +Inquiry |
| EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
| EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
