Recombinant Human EGFR Protein, Fc-tagged, Alexa Fluor 488 conjugated
| Cat.No. : | EGFR-629HAF488 |
| Product Overview : | Recombinant Human EGFR Protein (25-378aa), was expressed in HEK293 with C-terminal Fc tag and Alexa Fluor 488 conjugate. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 25-378 aa |
| Form : | Lyophilized |
| AA Sequence : | LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNI KHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE NLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQ KTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHV CHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK |
| Endotoxin : | < 0.1 ng/ μg (1 EU/ μg). |
| Purity : | > 95 % as determined by SDS-PAGE |
| Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 488 via amines Excitation Wavelength: 488 nm Emission Wavelength: 515-545 nm |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 4 months. |
| Storage Buffer : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/mL. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Conjugation : | Alexa Fluor 488 |
| Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
| Official Symbol | EGFR |
| Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
| Gene ID | 1956 |
| mRNA Refseq | NM_201283 |
| Protein Refseq | NP_958440 |
| MIM | 131550 |
| UniProt ID | P00533 |
| ◆ Recombinant Proteins | ||
| EGFR-102MAF647 | Recombinant Mouse Egfr Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| EGFR-688HF | Active Recombinant Human EGFRvIII protein, His-tagged, FITC-Labeled | +Inquiry |
| EGFR-196H | Recombinant Human EGFR protein, His-tagged | +Inquiry |
| EGFR-42H | Recombinant Human EGFR protein, Flag-tagged, Biotinylated | +Inquiry |
| EGFR-0974H | Recombinant Human EGFR Protein (L25-A1210), eGFP, Strep II, 10×His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
| EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
| EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
| EGFR-151HKCL | Human EGFR Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
