Recombinant Human EGFR Protein, Fc-tagged, Alexa Fluor 555 conjugated
Cat.No. : | EGFR-629HAF555 |
Product Overview : | Alexa Fluor 555 conjugated recombinant human EGFR(Leu25-Ser378) fused with Fc tag at C-terminal was expressed in HEK293. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | Leu25-Ser378 |
Form : | Lyophilized |
AA Sequence : | LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNI KHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE NLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQ KTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHV CHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK |
Endotoxin : | < 0.1 ng/ μg (1 EU/ μg). |
Purity : | > 95 % as determined by SDS-PAGE |
Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 555 via amines With an excitation and emission maximum of 555/565 nm, Alexa Fluor 555 can be efficiently excited using a 543 nm He-Ne laser line and detected under standard TRITC/Cy3 filters. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 4 months. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/mL. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
Official Symbol | EGFR |
Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
Gene ID | 1956 |
mRNA Refseq | NM_201283 |
Protein Refseq | NP_958440 |
MIM | 131550 |
UniProt ID | P00533 |
◆ Recombinant Proteins | ||
EGFR-233H | Recombinant Human EGFR, Strep-tagged | +Inquiry |
EGFR-464HA | Recombinant Human EGFR protein, Fc-tagged, APC labeled | +Inquiry |
EGFR-3383C | Active Recombinant Cynomolgus EGFR protein(Met1-Ser645), His-tagged | +Inquiry |
EGFR-215R | Recombinant Rhesus macaque EGFR Protein, His-tagged | +Inquiry |
EGFR-0975H | Recombinant Human EGFR Protein (L25-G1022), eGFP, Strep II, 10×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFR-663HCL | Recombinant Human EGFR cell lysate | +Inquiry |
EGFR-1621MCL | Recombinant Mouse EGFR cell lysate | +Inquiry |
EGFR-1462RCL | Recombinant Rat EGFR cell lysate | +Inquiry |
EGFR-2733HCL | Recombinant Human EGFR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
0
Inquiry Basket