Recombinant Human EGR1

• Cat.No.: EGR1-28467TH
• Product Overview: Recombinant fragment correponding to amino acids 444-543 of Human Egr1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
• Sequence Similarities: Belongs to the EGR C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.

Gene Information

• Gene Name: EGR1 early growth response 1 [ Homo sapiens ]
• Official Symbol: EGR1
• Synonyms: EGR1; early growth response 1; early growth response protein 1; AT225; G0S30; KROX 24; nerve growth factor induced protein A; NGFI A; TIS8; transcription factor ETR103; ZIF 268; zinc finger protein 225; ZNF225
• Gene ID: 1958
• mRNA Refseq: NM_001964
• Protein Refseq: NP_001955
• MIM: 128990
• Uniprot ID: P18146
• Chromosome Location: 5q23-q31
• Pathway: Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem
• Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity; double-stranded DNA binding; histone acetyltransferase binding; metal ion binding