Recombinant Human EGR1 Protein (444-543 aa), His-tagged
Cat.No. : | EGR1-1384H |
Product Overview : | Recombinant Human EGR1 Protein (444-543 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 444-543 aa |
Description : | Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 12.1 kDa |
AA Sequence : | SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | EGR1 early growth response 1 [ Homo sapiens ] |
Official Symbol | EGR1 |
Synonyms | EGR1; AT225; G0S30; KROX 24; NGFI A; TIS8; ZIF 268; ZNF225; EGR-1; NGFI-A; KROX-24; ZIF-268; |
Gene ID | 1958 |
mRNA Refseq | NM_001964 |
Protein Refseq | NP_001955 |
MIM | 128990 |
UniProt ID | P18146 |
◆ Recombinant Proteins | ||
EGR1-5712C | Recombinant Chicken EGR1 | +Inquiry |
EGR1-5052M | Recombinant Mouse EGR1 Protein | +Inquiry |
EGR1-1224R | Recombinant Rhesus Macaque EGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGR1-52 | Recombinant Human EGR1 protein, His-tagged | +Inquiry |
EGR1-1384H | Recombinant Human EGR1 Protein (444-543 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGR1-6692HCL | Recombinant Human EGR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGR1 Products
Required fields are marked with *
My Review for All EGR1 Products
Required fields are marked with *