Recombinant Human EGR1 Protein (444-543 aa), His-tagged

Cat.No. : EGR1-1384H
Product Overview : Recombinant Human EGR1 Protein (444-543 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 444-543 aa
Description : Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 12.1 kDa
AA Sequence : SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name EGR1 early growth response 1 [ Homo sapiens ]
Official Symbol EGR1
Synonyms EGR1; AT225; G0S30; KROX 24; NGFI A; TIS8; ZIF 268; ZNF225; EGR-1; NGFI-A; KROX-24; ZIF-268;
Gene ID 1958
mRNA Refseq NM_001964
Protein Refseq NP_001955
MIM 128990
UniProt ID P18146

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGR1 Products

Required fields are marked with *

My Review for All EGR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon