Recombinant Human EGR1 Protein (444-543 aa), His-tagged

• Cat.No.: EGR1-1384H
• Product Overview: Recombinant Human EGR1 Protein (444-543 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transcription. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 444-543 aa
• Description: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 12.1 kDa
• AA Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: EGR1 early growth response 1 [ Homo sapiens ]
• Official Symbol: EGR1
• Synonyms: EGR1; AT225; G0S30; KROX 24; NGFI A; TIS8; ZIF 268; ZNF225; EGR-1; NGFI-A; KROX-24; ZIF-268
• Gene ID: 1958
• mRNA Refseq: NM_001964
• Protein Refseq: NP_001955
• MIM: 128990
• UniProt ID: P18146