Recombinant Human EGR2
Cat.No. : | EGR2-28469TH |
Product Overview : | Recombinant fragment corresponding to amino acids 217-293 of Human EGR2 with an N terminal proprietary tag; Predicted MWt 34.10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 77 amino acids |
Description : | The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. |
Molecular Weight : | 34.100kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR |
Sequence Similarities : | Belongs to the EGR C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
Gene Name | EGR2 early growth response 2 [ Homo sapiens ] |
Official Symbol | EGR2 |
Synonyms | EGR2; early growth response 2; early growth response 2 (Krox 20 homolog, Drosophila) , KROX20; early growth response protein 2; Krox 20 homolog; Drosophila; |
Gene ID | 1959 |
mRNA Refseq | NM_001136178 |
Protein Refseq | NP_001129650 |
MIM | 129010 |
Uniprot ID | P11161 |
Chromosome Location | 10q21.1 |
Pathway | Adipogenesis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | DNA binding; RNA polymerase II activating transcription factor binding; chromatin binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
EGR2-1225R | Recombinant Rhesus Macaque EGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Egr2-30M | Recombinant Mouse Egr2 protein, His-tagged | +Inquiry |
EGR2-2033R | Recombinant Rat EGR2 Protein | +Inquiry |
EGR2-1400R | Recombinant Rhesus monkey EGR2 Protein, His-tagged | +Inquiry |
EGR2-12329H | Recombinant Human EGR2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGR2-6691HCL | Recombinant Human EGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGR2 Products
Required fields are marked with *
My Review for All EGR2 Products
Required fields are marked with *
0
Inquiry Basket