Recombinant Human EGR2
| Cat.No. : | EGR2-28469TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 217-293 of Human EGR2 with an N terminal proprietary tag; Predicted MWt 34.10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 77 amino acids |
| Description : | The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. |
| Molecular Weight : | 34.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR |
| Sequence Similarities : | Belongs to the EGR C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers. |
| Gene Name | EGR2 early growth response 2 [ Homo sapiens ] |
| Official Symbol | EGR2 |
| Synonyms | EGR2; early growth response 2; early growth response 2 (Krox 20 homolog, Drosophila) , KROX20; early growth response protein 2; Krox 20 homolog; Drosophila; |
| Gene ID | 1959 |
| mRNA Refseq | NM_001136178 |
| Protein Refseq | NP_001129650 |
| MIM | 129010 |
| Uniprot ID | P11161 |
| Chromosome Location | 10q21.1 |
| Pathway | Adipogenesis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
| Function | DNA binding; RNA polymerase II activating transcription factor binding; chromatin binding; metal ion binding; protein binding; |
| ◆ Recombinant Proteins | ||
| EGR2-2683M | Recombinant Mouse EGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EGR2-4266HF | Recombinant Full Length Human EGR2 Protein, GST-tagged | +Inquiry |
| EGR2-5053M | Recombinant Mouse EGR2 Protein | +Inquiry |
| EGR2-6976H | Recombinant Human EGR2 protein, His & T7-tagged | +Inquiry |
| EGR2-3123H | Recombinant Human EGR2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGR2-6691HCL | Recombinant Human EGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGR2 Products
Required fields are marked with *
My Review for All EGR2 Products
Required fields are marked with *
