Recombinant Human EHD3 Protein, GST-tagged
Cat.No. : | EHD3-3131H |
Product Overview : | Human EHD3 partial ORF ( NP_055415, 357 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EHD3 (EH Domain Containing 3) is a Protein Coding gene. Among its related pathways are Endocytosis and Cholesterol and Sphingolipids transport / Recycling to plasma membrane in lung (normal and CF). GO annotations related to this gene include nucleic acid binding and GTP binding. An important paralog of this gene is EHD1. |
Molecular Mass : | 31.24 kDa |
AA Sequence : | KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EHD3 EH-domain containing 3 [ Homo sapiens ] |
Official Symbol | EHD3 |
Synonyms | EHD3; EH-domain containing 3; PAST3; EH domain-containing protein 3; PAST homolog 3; EH domain containing 3; |
Gene ID | 30845 |
mRNA Refseq | NM_014600 |
Protein Refseq | NP_055415 |
MIM | 605891 |
UniProt ID | Q9NZN3 |
◆ Recombinant Proteins | ||
EHD3-12334H | Recombinant Human EHD3, GST-tagged | +Inquiry |
EHD3-395H | Recombinant Human EHD3 Protein, His-tagged | +Inquiry |
EHD3-2720C | Recombinant Chicken EHD3 | +Inquiry |
EHD3-2038R | Recombinant Rat EHD3 Protein | +Inquiry |
EHD3-2687M | Recombinant Mouse EHD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EHD3-6689HCL | Recombinant Human EHD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EHD3 Products
Required fields are marked with *
My Review for All EHD3 Products
Required fields are marked with *