Recombinant Human EHD3 Protein, GST-tagged

Cat.No. : EHD3-3131H
Product Overview : Human EHD3 partial ORF ( NP_055415, 357 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EHD3 (EH Domain Containing 3) is a Protein Coding gene. Among its related pathways are Endocytosis and Cholesterol and Sphingolipids transport / Recycling to plasma membrane in lung (normal and CF). GO annotations related to this gene include nucleic acid binding and GTP binding. An important paralog of this gene is EHD1.
Molecular Mass : 31.24 kDa
AA Sequence : KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EHD3 EH-domain containing 3 [ Homo sapiens ]
Official Symbol EHD3
Synonyms EHD3; EH-domain containing 3; PAST3; EH domain-containing protein 3; PAST homolog 3; EH domain containing 3;
Gene ID 30845
mRNA Refseq NM_014600
Protein Refseq NP_055415
MIM 605891
UniProt ID Q9NZN3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EHD3 Products

Required fields are marked with *

My Review for All EHD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon