Recombinant Human EIF2AK3 Protein, GST-tagged

Cat.No. : EIF2AK3-3151H
Product Overview : Human EIF2AK3 partial ORF ( NP_002437, 665 a.a. - 764 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene phosphorylates the alpha subunit of eukaryotic translation-initiation factor 2, leading to its inactivation, and thus to a rapid reduction of translational initiation and repression of global protein synthesis. This protein is thought to modulate mitochondrial function. It is a type I membrane protein located in the endoplasmic reticulum (ER), where it is induced by ER stress caused by malfolded proteins. Mutations in this gene are associated with Wolcott-Rallison syndrome. [provided by RefSeq, Sep 2015]
Molecular Mass : 36.63 kDa
AA Sequence : KWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF2AK3 eukaryotic translation initiation factor 2-alpha kinase 3 [ Homo sapiens ]
Official Symbol EIF2AK3
Synonyms EIF2AK3; eukaryotic translation initiation factor 2-alpha kinase 3; PEK; PERK; hsPEK; pancreatic EIF2-alpha kinase; PRKR-like endoplasmic reticulum kinase; eukaryotic translation initiation factor 2 alpha kinase 3; WRS; DKFZp781H1925;
Gene ID 9451
mRNA Refseq NM_004836
Protein Refseq NP_004827
MIM 604032
UniProt ID Q9NZJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2AK3 Products

Required fields are marked with *

My Review for All EIF2AK3 Products

Required fields are marked with *

0
cart-icon