Recombinant Human EIF2AK3 Protein, GST-tagged

• Cat.No.: EIF2AK3-3151H
• Product Overview: Human EIF2AK3 partial ORF ( NP_002437, 665 a.a. - 764 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene phosphorylates the alpha subunit of eukaryotic translation-initiation factor 2, leading to its inactivation, and thus to a rapid reduction of translational initiation and repression of global protein synthesis. This protein is thought to modulate mitochondrial function. It is a type I membrane protein located in the endoplasmic reticulum (ER), where it is induced by ER stress caused by malfolded proteins. Mutations in this gene are associated with Wolcott-Rallison syndrome. [provided by RefSeq, Sep 2015]
• Molecular Mass: 36.63 kDa
• AA Sequence: KWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF2AK3 eukaryotic translation initiation factor 2-alpha kinase 3 [ Homo sapiens ]
• Official Symbol: EIF2AK3
• Synonyms: EIF2AK3; eukaryotic translation initiation factor 2-alpha kinase 3; PEK; PERK; hsPEK; pancreatic EIF2-alpha kinase; PRKR-like endoplasmic reticulum kinase; eukaryotic translation initiation factor 2 alpha kinase 3; WRS; DKFZp781H1925
• Gene ID: 9451
• mRNA Refseq: NM_004836
• Protein Refseq: NP_004827
• MIM: 604032
• UniProt ID: Q9NZJ5