Recombinant Human EIF2AK3 Protein, GST-tagged
Cat.No. : | EIF2AK3-3151H |
Product Overview : | Human EIF2AK3 partial ORF ( NP_002437, 665 a.a. - 764 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene phosphorylates the alpha subunit of eukaryotic translation-initiation factor 2, leading to its inactivation, and thus to a rapid reduction of translational initiation and repression of global protein synthesis. This protein is thought to modulate mitochondrial function. It is a type I membrane protein located in the endoplasmic reticulum (ER), where it is induced by ER stress caused by malfolded proteins. Mutations in this gene are associated with Wolcott-Rallison syndrome. [provided by RefSeq, Sep 2015] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | KWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF2AK3 eukaryotic translation initiation factor 2-alpha kinase 3 [ Homo sapiens ] |
Official Symbol | EIF2AK3 |
Synonyms | EIF2AK3; eukaryotic translation initiation factor 2-alpha kinase 3; PEK; PERK; hsPEK; pancreatic EIF2-alpha kinase; PRKR-like endoplasmic reticulum kinase; eukaryotic translation initiation factor 2 alpha kinase 3; WRS; DKFZp781H1925; |
Gene ID | 9451 |
mRNA Refseq | NM_004836 |
Protein Refseq | NP_004827 |
MIM | 604032 |
UniProt ID | Q9NZJ5 |
◆ Recombinant Proteins | ||
EIF2AK3-1413H | Recombinant Human EIF2AK3 Protein, His-tagged | +Inquiry |
EIF2AK3-819H | Recombinant Human EIF2AK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2AK3-1020H | Recombinant Human EIF2AK3 Protein, His-tagged | +Inquiry |
EIF2AK3-337H | Recombinant Human EIF2AK3 Protein, MYC/DDK-tagged | +Inquiry |
EIF2AK3-1702R | Recombinant Rat EIF2AK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2AK3-6673HCL | Recombinant Human EIF2AK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF2AK3 Products
Required fields are marked with *
My Review for All EIF2AK3 Products
Required fields are marked with *
0
Inquiry Basket