Recombinant Human EIF2AK3 Protein, GST-tagged
| Cat.No. : | EIF2AK3-3151H |
| Product Overview : | Human EIF2AK3 partial ORF ( NP_002437, 665 a.a. - 764 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene phosphorylates the alpha subunit of eukaryotic translation-initiation factor 2, leading to its inactivation, and thus to a rapid reduction of translational initiation and repression of global protein synthesis. This protein is thought to modulate mitochondrial function. It is a type I membrane protein located in the endoplasmic reticulum (ER), where it is induced by ER stress caused by malfolded proteins. Mutations in this gene are associated with Wolcott-Rallison syndrome. [provided by RefSeq, Sep 2015] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | KWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF2AK3 eukaryotic translation initiation factor 2-alpha kinase 3 [ Homo sapiens ] |
| Official Symbol | EIF2AK3 |
| Synonyms | EIF2AK3; eukaryotic translation initiation factor 2-alpha kinase 3; PEK; PERK; hsPEK; pancreatic EIF2-alpha kinase; PRKR-like endoplasmic reticulum kinase; eukaryotic translation initiation factor 2 alpha kinase 3; WRS; DKFZp781H1925; |
| Gene ID | 9451 |
| mRNA Refseq | NM_004836 |
| Protein Refseq | NP_004827 |
| MIM | 604032 |
| UniProt ID | Q9NZJ5 |
| ◆ Recombinant Proteins | ||
| EIF2AK3-337H | Recombinant Human EIF2AK3 Protein, MYC/DDK-tagged | +Inquiry |
| EIF2AK3-819H | Recombinant Human EIF2AK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EIF2AK3-2045R | Recombinant Rat EIF2AK3 Protein | +Inquiry |
| EIF2AK3-1010H | Recombinant Human Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, GST-tagged | +Inquiry |
| EIF2AK3-013H | Recombinant Human eukaryotic translation initiation factor 2-alpha kinase 3 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2AK3-6673HCL | Recombinant Human EIF2AK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2AK3 Products
Required fields are marked with *
My Review for All EIF2AK3 Products
Required fields are marked with *
