Recombinant Human EIF2B3, His-tagged
| Cat.No. : | EIF2B3-28491TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 167-452 of Human eIF2B3 with an N terminal His tag. Predicted MWt: 33 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 167-452 a.a. |
| Description : | The protein encoded by this gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 66 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYC LKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQ GQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACW NACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEA NRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTV EEGSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI |
| Sequence Similarities : | Belongs to the eIF-2B gamma/epsilon subunits family. |
| Gene Name | EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa [ Homo sapiens ] |
| Official Symbol | EIF2B3 |
| Synonyms | EIF2B3; eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa; eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD); translation initiation factor eIF-2B subunit gamma; EIF 2B; EIF2Bgamma; |
| Gene ID | 8891 |
| mRNA Refseq | NM_020365 |
| Protein Refseq | NP_065098 |
| MIM | 606273 |
| Uniprot ID | Q9NR50 |
| Chromosome Location | 1p34.1 |
| Pathway | Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; RNA transport, organism-specific biosystem; |
| Function | contributes_to guanyl-nucleotide exchange factor activity; contributes_to guanyl-nucleotide exchange factor activity; nucleotidyltransferase activity; protein binding; contributes_to translation factor activity, nucleic acid binding; |
| ◆ Recombinant Proteins | ||
| EIF2B3-4557H | Recombinant Human EIF2B3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Eif2b3-5176R | Recombinant Rat Eif2b3 protein | +Inquiry |
| EIF2B3-333H | Recombinant Human EIF2B3 Protein, His-tagged | +Inquiry |
| EIF2B3-2937C | Recombinant Chicken EIF2B3 | +Inquiry |
| Eif2b3-357M | Recombinant Mouse Eif2b3 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF2B3-6671HCL | Recombinant Human EIF2B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2B3 Products
Required fields are marked with *
My Review for All EIF2B3 Products
Required fields are marked with *
