Recombinant Human EIF2B3 protein, His-tagged
Cat.No. : | EIF2B3-3153H |
Product Overview : | Recombinant Human EIF2B3 protein(15-232 aa), fused to His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 15-232 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa [ Homo sapiens ] |
Official Symbol | EIF2B3 |
Synonyms | EIF2B3; eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa; eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD); translation initiation factor eIF-2B subunit gamma; EIF 2B; EIF2Bgamma; eIF-2B GDP-GTP exchange factor subunit gamma; EIF-2B; |
Gene ID | 8891 |
mRNA Refseq | NM_001166588 |
Protein Refseq | NP_001160060 |
MIM | 606273 |
UniProt ID | Q9NR50 |
◆ Recombinant Proteins | ||
EIF2B3-1416R | Recombinant Rhesus monkey EIF2B3 Protein, His-tagged | +Inquiry |
Eif2b3-5175R | Recombinant Rat Eif2b3 protein | +Inquiry |
EIF2B3-1704R | Recombinant Rat EIF2B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF2B3-4491HF | Recombinant Full Length Human EIF2B3 Protein, GST-tagged | +Inquiry |
Eif2b3-357M | Recombinant Mouse Eif2b3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF2B3-6671HCL | Recombinant Human EIF2B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2B3 Products
Required fields are marked with *
My Review for All EIF2B3 Products
Required fields are marked with *