Recombinant Human EIF2B4 Protein, GST-tagged

Cat.No. : EIF2B4-3158H
Product Overview : Human EIF2B4 partial ORF ( NP_056451, 433 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Eukaryotic initiation factor 2B (EIF2B), which is necessary for protein synthesis, is a GTP exchange factor composed of five different subunits. The protein encoded by this gene is the fourth, or delta, subunit. Defects in this gene are a cause of leukoencephalopathy with vanishing white matter (VWM) and ovarioleukodystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.64 kDa
AA Sequence : VLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHASLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF2B4 eukaryotic translation initiation factor 2B subunit delta [ Homo sapiens (human) ]
Official Symbol EIF2B4
Synonyms EIF2B4; eukaryotic translation initiation factor 2B subunit delta; Eukaryotic Translation Initiation Factor 2B Subunit Delta; Eukaryotic Translation Initiation Factor 2B, Subunit 4 Delta, 67kDa; EIF-2B GDP-GTP Exchange Factor Subunit Delta; Eukaryotic Translation Initiation Factor 2B, Subunit 4 (Delta, 67kD); Eukaryotic Translation Initiation Factor 2B Subunit 4 Delta; Translation Initiation Factor EIF-2B Subunit Delta; Translation Initiation Factor EIF-2b Delta Subunit; EIF2Bdelta; EIF-2B; EIF2BD; EIF2B; translation initiation factor eIF-2B subunit delta; eIF-2B GDP-GTP exchange factor subunit delta; eukaryotic translation initiation factor 2B subunit 4 delta; eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa; translation initiation factor eIF-2b delta subunit
Gene ID 8890
mRNA Refseq NM_001034116
Protein Refseq NP_001029288
MIM 606687
UniProt ID Q9UI10

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2B4 Products

Required fields are marked with *

My Review for All EIF2B4 Products

Required fields are marked with *

0
cart-icon
0
compare icon