Recombinant Human EIF2C4 Protein, GST-tagged

Cat.No. : EIF2C4-3169H
Product Overview : Human EIF2C4 partial ORF ( NP_060099.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a translation initiation factor involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. This gene was previously referred to as ligatin, but is now known to localize to the cytoplasm and localize and function with translation factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Molecular Mass : 36.74 kDa
AA Sequence : MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF2C4 eukaryotic translation initiation factor 2C, 4 [ Homo sapiens ]
Official Symbol EIF2C4
Synonyms EIF2C4; eukaryotic translation initiation factor 2C, 4; protein argonaute-4; AGO4; argonaute 4; FLJ20033; KIAA1567; hAgo4; eIF2C 4; eIF-2C 4; argonaute4;
Gene ID 192670
mRNA Refseq NM_017629
Protein Refseq NP_060099
MIM 607356
UniProt ID Q9HCK5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF2C4 Products

Required fields are marked with *

My Review for All EIF2C4 Products

Required fields are marked with *

0
cart-icon
0
compare icon