Recombinant Human EIF2C4 Protein, GST-tagged
| Cat.No. : | EIF2C4-3169H |
| Product Overview : | Human EIF2C4 partial ORF ( NP_060099.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a translation initiation factor involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. This gene was previously referred to as ligatin, but is now known to localize to the cytoplasm and localize and function with translation factors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MEALGPGPPASLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDVDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF2C4 eukaryotic translation initiation factor 2C, 4 [ Homo sapiens ] |
| Official Symbol | EIF2C4 |
| Synonyms | EIF2C4; eukaryotic translation initiation factor 2C, 4; protein argonaute-4; AGO4; argonaute 4; FLJ20033; KIAA1567; hAgo4; eIF2C 4; eIF-2C 4; argonaute4; |
| Gene ID | 192670 |
| mRNA Refseq | NM_017629 |
| Protein Refseq | NP_060099 |
| MIM | 607356 |
| UniProt ID | Q9HCK5 |
| ◆ Recombinant Proteins | ||
| EIF2C4-1417H | Recombinant Human EIF2C4 Protein, His-tagged | +Inquiry |
| Eif2c4-1418R | Recombinant Rat Eif2c4 Protein, His-tagged | +Inquiry |
| EIF2C4-3169H | Recombinant Human EIF2C4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF2C4 Products
Required fields are marked with *
My Review for All EIF2C4 Products
Required fields are marked with *
