Recombinant Human EIF3D, His-tagged
Cat.No. : | EIF3D-26387TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 148-330 of Human EIF3D with an N terminal His tag; Predicted MWt 22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 148-330 a.a. |
Description : | Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEV SEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFH TVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVY SWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQD EGNSFNSPRNLAMEATYINHNFSQQCLRM |
Sequence Similarities : | Belongs to the eIF-3 subunit D family. |
Gene Name | EIF3D eukaryotic translation initiation factor 3, subunit D [ Homo sapiens ] |
Official Symbol | EIF3D |
Synonyms | EIF3D; eukaryotic translation initiation factor 3, subunit D; EIF3S7, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; eukaryotic translation initiation factor 3 subunit D; eIF3 p66; eIF3 zeta; eIF3d; |
Gene ID | 8664 |
mRNA Refseq | NM_003753 |
Protein Refseq | NP_003744 |
MIM | 603915 |
Uniprot ID | O15371 |
Chromosome Location | 22q13.1 |
Pathway | Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; |
Function | protein binding; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity; |
◆ Recombinant Proteins | ||
EIF3D-2711M | Recombinant Mouse EIF3D Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3D-5094M | Recombinant Mouse EIF3D Protein | +Inquiry |
EIF3D-3178H | Recombinant Human EIF3D Protein, GST-tagged | +Inquiry |
EIF3D-3179H | Recombinant Human EIF3D protein, GST-tagged | +Inquiry |
EIF3D-1245R | Recombinant Rhesus Macaque EIF3D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3D-6663HCL | Recombinant Human EIF3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3D Products
Required fields are marked with *
My Review for All EIF3D Products
Required fields are marked with *